DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and CG43110

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster


Alignment Length:271 Identity:83/271 - (30%)
Similarity:128/271 - (47%) Gaps:45/271 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 CGQSLSTYRMVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCVNGIPRDL 144
            ||:: ...:::.||.|......:||.:  .|||.|    .|.|::|:..:|||.|||     :..
  Fly    28 CGKT-PVPKIISGSNASQQSAQYMAGI--FNTTHL----LCGGTIIHEDFVLTVAHC-----KST 80

  Fly   145 SLKSVRLGEHDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIEYDIALLRLK 209
            ....||||.::|.:                 |..:|::.:.|.|..:|:.:..|   ||||::|:
  Fly    81 QTLFVRLGAYNINH-----------------PTDQIRVIETIAHPQYSNSTYAN---DIALVKLE 125

  Fly   210 MPVRYRTGIMPICIPKHGFFAKS--KLEIAGWGKTNEGQFSQVLMHGFIRERSIAVCALRFPYLD 272
            ..|.:...|.||||.......|.  .....|||:|...:.|.:|...|:...:..:|.|   ||.
  Fly   126 RSVIFNLNIQPICIHLDATLGKQIRYYNAFGWGRTRNAEQSDILQRIFVNRTNPMICHL---YLG 187

  Fly   273 LN-QSLQICAGGYDGVDTCQGDSGGPLM--VTMDNSSVYLA-GITTYGSKNCGQIGIPGIYTRTS 333
            :: ...||||....| |||.|||||||:  :|....:.... |||:||::.|..:   |:||..|
  Fly   188 MSPDPKQICATTDQG-DTCAGDSGGPLISKITYQGKNFDTQFGITSYGTRECNGV---GLYTDVS 248

  Fly   334 AFLPWIKAVLR 344
            .:..||..::|
  Fly   249 QYSGWIANIVR 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 78/256 (30%)
Tryp_SPc 90..342 CDD:238113 80/257 (31%)
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 78/256 (30%)
Tryp_SPc 36..257 CDD:238113 80/258 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463486
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.