DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and CG43124

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:215 Identity:52/215 - (24%)
Similarity:79/215 - (36%) Gaps:82/215 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 RMVGGSEARPNGYPWMAMLLYLNTTTLEILP----FCAGSLINNRYVLTSAHCVNGIPRDLSLKS 148
            |:.|.|.|     ||:|          |||.    .|||:||||.||||:|.|.    ::....:
  Fly    33 RINGSSYA-----PWLA----------EILSDSKVICAGALINNLYVLTAASCF----KENEKLT 78

  Fly   149 VRLGEHDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIEYDIALLRLKMPVR 213
            ||||..  .:|.:|.               ..::.|..........:|.|   ::.:.||:..|.
  Fly    79 VRLGSG--YFDKSYE---------------NFRVTKAYFWMTHFPANNTN---NLCIFRLQTEVE 123

  Fly   214 YRTGIMPICI-------------------PKHGFFAK-------------------SKLEIAGWG 240
            ::|.|.|:||                   ||..:|.|                   ||...:.|.
  Fly   124 FKTHIRPMCITKSPKSLGLATTFEIINEKPKMWYFCKNIKGLFCKYVFGENEEKWQSKPTGSPWT 188

  Fly   241 KT-NEGQFSQVLMHGFIRER 259
            :| :.|.|..::.:|.:..|
  Fly   189 ETISNGPFKGLVRYGILSYR 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 52/215 (24%)
Tryp_SPc 90..342 CDD:238113 51/213 (24%)
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 34/125 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.