DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and CG43125

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster


Alignment Length:296 Identity:85/296 - (28%)
Similarity:128/296 - (43%) Gaps:80/296 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 AWLLFGQRICCPPPGNRLPSTEICGQSLSTYRMVGGSEARPNGYPWMAML---LYLNTTTLEILP 118
            |.|||.|       |:.|...:.||:| |.:     |.|     ||:..:   |..|.|      
  Fly    11 ALLLFYQ-------GSALFLEQNCGKS-SVF-----SPA-----PWLVKIRPELSSNIT------ 51

  Fly   119 FCAGSLINNRYVLTSAHCVNGIPRDLSLKSVRLGEHDITYDPAYNPDCRDQDNQCALPNLEIKLE 183
             |.|:|||.|:|||:|.|:: ...:|   .|||||.|.|.           .|...|...||.:.
  Fly    52 -CTGTLINERFVLTAASCID-YQTEL---IVRLGEIDGTL-----------QNSSKLQYEEIYVA 100

  Fly   184 KIIVHGLFSSISNRNIEYDIALLRLKMPVRYRTGIMPICI-------PKHGFF--AKSKLEIAGW 239
            :.::|..:||.|:   :|:|||||||..|.|:..|.||||       ||...|  .|.|.|..  
  Fly   101 RALIHRSYSSESH---QYNIALLRLKTSVVYKKNIQPICIDVNVGKVPKAPTFEIEKKKNEEP-- 160

  Fly   240 GKTNEGQFSQVLMHGFIRERSIAVCALRFPYLDLNQSLQICAGGYDGVDTCQGDSGGPLMVTMDN 304
             |.|:....:..::.|     :::..:|.|..|:....|..|.|:            ||...::.
  Fly   161 -KKNKAGIMKRFLNWF-----LSLFGVREPRPDVILPPQPIAVGW------------PLTKQINE 207

  Fly   305 SSVY-LAGITTYGSKNCGQIGIPGIYTRTSAFLPWI 339
            |::: ..||.::.:....:    .:||...|::.||
  Fly   208 SALFHQYGILSHRNSESKK----DVYTDVMAYVNWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 72/263 (27%)
Tryp_SPc 90..342 CDD:238113 74/263 (28%)
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 45/124 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463607
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.