DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and proc.2

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001120289.1 Gene:proc.2 / 100145345 XenbaseID:XB-GENE-5882297 Length:681 Species:Xenopus tropicalis


Alignment Length:279 Identity:82/279 - (29%)
Similarity:126/279 - (45%) Gaps:69/279 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 RMVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCVNG-IPRDLSLKSVRL 151
            |:|||........||..::     .......||.||||::|:||::|||... ||.     .|.:
 Frog   435 RIVGGMRCELGQCPWQVLI-----RNNRGFGFCGGSLISSRWVLSAAHCFESQIPH-----HVTI 489

  Fly   152 GEHDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFS--SISNRNIEYDIALLRLKMPVRY 214
            |::| ||.       ||.|.|           ||.|..:||  :......::|||||.|:.|..:
 Frog   490 GDYD-TYR-------RDMDEQ-----------KIAVLQVFSHPNYLAEFYDHDIALLFLRSPAMF 535

  Fly   215 RTGIMPICIPKHGFFAKSKL--------EIAGWGKTNE-GQFSQVLMHGFIRERSIAVCALRFPY 270
            .....|||:|..|.   .|:        :::|||.|.: |.:::.|:            .:|.|.
 Frog   536 GEYSRPICLPNPGL---GKMLTQEGQTGQVSGWGATRQFGPYTRFLL------------KVRLPI 585

  Fly   271 LDLNQSL----------QICAGGYDGV-DTCQGDSGGPLMVTMDNSSVYLAGITTYGSKNCGQIG 324
            :.....:          ..|||..:|| |.|.||||||..| :.:.:.:|.|:.::|. .|.:.|
 Frog   586 VSQETCMASTENILTGNMFCAGYKEGVKDACSGDSGGPFAV-LFHDTWFLVGVVSWGD-GCAEKG 648

  Fly   325 IPGIYTRTSAFLPWIKAVL 343
            ..|:|||.:.::||||..:
 Frog   649 KYGVYTRVANYMPWIKETI 667

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 79/273 (29%)
Tryp_SPc 90..342 CDD:238113 81/274 (30%)
proc.2NP_001120289.1 GLA 19..80 CDD:214503
EGF_CA 81..117 CDD:238011
FXa_inhibition 123..160 CDD:373209
Tryp_SPc 436..666 CDD:238113 81/275 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.