DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and LOC100004411

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_001343728.4 Gene:LOC100004411 / 100004411 -ID:- Length:494 Species:Danio rerio


Alignment Length:344 Identity:94/344 - (27%)
Similarity:152/344 - (44%) Gaps:81/344 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 HSTNSDCYPGEKYVYLYECPHVYTAGRSRTLMREYDMDAWLLFGQRICCPPPGNRLPS-TEICGQ 82
            ||:.|..:|         ..|..:|..:.|...:.::.|            |...|.: ::..|.
Zfish   200 HSSTSPSHP---------LHHNRSALENSTHQNQTELTA------------PDQLLDTGSDFTGG 243

  Fly    83 SLSTYRMVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCVNGIPRDLSLK 147
            :..| |:|||...|..|.||..:|     ...:...||.|||||.|:|:|:|||:...|..::  
Zfish   244 NEDT-RIVGGQLQRQGGSPWQVLL-----RREDEYGFCGGSLINQRWVITAAHCLQQTPHHIT-- 300

  Fly   148 SVRLGEHDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIEYDIALLRLKMPV 212
               :|::|     ...|   |:|.|      :|.:||||.|..:...:   .:.|||||.|...|
Zfish   301 ---IGDYD-----KMRP---DKDEQ------KITVEKIIPHPHYHEYT---FDSDIALLYLSSAV 345

  Fly   213 RYRTGIMPICIPKHGFFAKSKLE------IAGWGKTNEGQFSQVLMHGFIRERSIAVCALRFPYL 271
            .......|.|:|... .|:..::      ::|||.|:..|.|.    .|:|:       ::.|.:
Zfish   346 TLGPFASPACLPDAN-LAERLMKPGEQGLVSGWGSTHYLQRSS----RFLRK-------VQLPVV 398

  Fly   272 D----LNQSLQI------CAGG-YDGVDTCQGDSGGPLMVTMDNSSVYLAGITTYGSKNCGQIGI 325
            :    :|.:.||      |||. .:.:|.|.||||||.:|.. ..:.:|.|:.::|.: |...|.
Zfish   399 EQKSCINSTEQIITDNMFCAGFLMEEMDACTGDSGGPFIVNY-RGTWFLTGVVSWGER-CASQGK 461

  Fly   326 PGIYTRTSAFLPWIKAVLR 344
            .|:|||...:|.||:..::
Zfish   462 YGVYTRLGNYLSWIQEEMK 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 80/267 (30%)
Tryp_SPc 90..342 CDD:238113 81/268 (30%)
LOC100004411XP_001343728.4 GLA 22..85 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 128..164 CDD:291342
Tryp_SPc 248..475 CDD:214473 80/267 (30%)
Tryp_SPc 249..477 CDD:238113 81/268 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.