DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6195 and AT4G39520

DIOPT Version :9

Sequence 1:NP_650822.1 Gene:CG6195 / 42343 FlyBaseID:FBgn0038723 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_195662.1 Gene:AT4G39520 / 830106 AraportID:AT4G39520 Length:369 Species:Arabidopsis thaliana


Alignment Length:365 Identity:202/365 - (55%)
Similarity:267/365 - (73%) Gaps:4/365 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ILEKIAEIEREIARTQKNKATEYHLGLLKAKLAKYRSQLLEPSKK---GEKGDGFDVLKSGDARV 64
            |::||.|||.|:|:|||||||.:|||||||||||.|..||.|..|   |..|:||||.||||:||
plant     4 IMQKIKEIEDEMAKTQKNKATSHHLGLLKAKLAKLRRDLLAPPTKGGGGGAGEGFDVTKSGDSRV 68

  Fly    65 ALIGFPSVGKSTMLSTLTKTESEAANYEFTTLTCIPGVIEYQGANIQLLDLPGIIEGAAQGKGRG 129
            .|:|||||||||:|:.||.|.||.|:|||||||||||||.|:||.|||||||||||||..|||||
plant    69 GLVGFPSVGKSTLLNKLTGTFSEVASYEFTTLTCIPGVITYRGAKIQLLDLPGIIEGAKDGKGRG 133

  Fly   130 RQVIAVARTADLVLMMLDATKPNVHRELLERELESVGIRLNKRKPNIYFKQKKGGGLSFNATCSL 194
            ||||:.|||.:.:|::|||.||..|:.|:|:|||..||||||..||:.|::|..||::..:|.::
plant   134 RQVISTARTCNCILIVLDAIKPITHKRLIEKELEGFGIRLNKEPPNLTFRKKDKGGINLTSTVAV 198

  Fly   195 TRCNEKMVQTILHSFKIFNAEVLFREDCTEDEFIDVVTANRVYLPCLYVYNKIDQISIEEVDRLA 259
            |..:...|:.|...:::.||::..|.|.|.|:.|||:..:|:|:||:|..||||.|::||::.|.
plant   199 THLDLDTVKAICGEYRMHNADITLRYDATADDLIDVIEGSRIYMPCIYAVNKIDSITLEELEILD 263

  Fly   260 RQPNSIVVSCNMKLNLDYMMEALWEALQLIRVYTKKPGAPPDFDDGLIL-RKGVSVEHVCHAIHR 323
            :.|:...||.:::.|||.:::.:||.|.|.|:|||.....||:||.:|| .|..:||..|..||:
plant   264 KLPHYCPVSAHLEWNLDGLLDKIWEYLDLTRIYTKPKAMNPDYDDPVILSSKKRTVEDFCIRIHK 328

  Fly   324 TLAAQFKYALVWGTSTKYSPQRVGIAHVMADEDVIQVVKK 363
            .:..|||||||||:|.|:.|||||..|.:.||||:|:|||
plant   329 DMLKQFKYALVWGSSAKHKPQRVGKEHELEDEDVVQIVKK 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6195NP_650822.1 Rbg1 1..363 CDD:224085 200/363 (55%)
AT4G39520NP_195662.1 Rbg1 1..368 CDD:224085 200/363 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1163
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60797
OrthoDB 1 1.010 - - D754662at2759
OrthoFinder 1 1.000 - - FOG0001080
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.