DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6195 and drg1

DIOPT Version :9

Sequence 1:NP_650822.1 Gene:CG6195 / 42343 FlyBaseID:FBgn0038723 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001016294.1 Gene:drg1 / 549048 XenbaseID:XB-GENE-980752 Length:367 Species:Xenopus tropicalis


Alignment Length:365 Identity:205/365 - (56%)
Similarity:268/365 - (73%) Gaps:3/365 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GILEKIAEIEREIARTQKNKATEYHLGLLKAKLAKYRSQLLEP--SKKGEKGDGFDVLKSGDARV 64
            |.|.||||||.|:|||||||||.:|||||||:|||.|.:|:.|  ...|..|:||||.|:||||:
 Frog     3 GTLAKIAEIESEMARTQKNKATAHHLGLLKARLAKLRRELITPKGGGGGGPGEGFDVAKTGDARI 67

  Fly    65 ALIGFPSVGKSTMLSTLTKTESEAANYEFTTLTCIPGVIEYQGANIQLLDLPGIIEGAAQGKGRG 129
            ..:|||||||||:||.|....||.|.|||||||.:|||:.|:||.|||||||||||||..|||||
 Frog    68 GFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLTTVPGVVRYKGAKIQLLDLPGIIEGAKDGKGRG 132

  Fly   130 RQVIAVARTADLVLMMLDATKPNVHRELLERELESVGIRLNKRKPNIYFKQKKGGGLSFNATCSL 194
            |||||||||.:|:|::||..||..|::::|.|||..||||||:.|||.||:|..||::..|||:.
 Frog   133 RQVIAVARTCNLILIVLDVLKPLGHKKIIENELEGFGIRLNKQPPNIGFKKKDKGGINLTATCAQ 197

  Fly   195 TRCNEKMVQTILHSFKIFNAEVLFREDCTEDEFIDVVTANRVYLPCLYVYNKIDQISIEEVDRLA 259
            :..:...|::||..:||.||::..|.|.|.|:.||||..||||:||:||.|||||||:||:|.:.
 Frog   198 SELDNDTVKSILAEYKIHNADITLRSDATADDLIDVVEGNRVYIPCIYVLNKIDQISVEELDIIY 262

  Fly   260 RQPNSIVVSCNMKLNLDYMMEALWEALQLIRVYTKKPGAPPDFDDGLILR-KGVSVEHVCHAIHR 323
            :.|:.:.:|.:.:.|.|.::|.:|:.|||:|:|||..|..||:...::|. ...:.|..|..||:
 Frog   263 KVPHCVPISAHHRWNFDDLLEKIWDYLQLVRIYTKPKGQLPDYTSPVVLPFSRTAAEDFCTKIHK 327

  Fly   324 TLAAQFKYALVWGTSTKYSPQRVGIAHVMADEDVIQVVKK 363
            .|..:||||||||:|.|::||:||..||:.||||||:|||
 Frog   328 NLIKEFKYALVWGSSVKHNPQKVGKDHVLEDEDVIQIVKK 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6195NP_650822.1 Rbg1 1..363 CDD:224085 203/363 (56%)
drg1NP_001016294.1 Rbg1 1..367 CDD:224085 203/363 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D348788at33208
OrthoFinder 1 1.000 - - FOG0001080
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.