DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6195 and Non1

DIOPT Version :9

Sequence 1:NP_650822.1 Gene:CG6195 / 42343 FlyBaseID:FBgn0038723 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001286247.1 Gene:Non1 / 35963 FlyBaseID:FBgn0028473 Length:652 Species:Drosophila melanogaster


Alignment Length:364 Identity:66/364 - (18%)
Similarity:124/364 - (34%) Gaps:131/364 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KIAEIEREIARTQKNKATEYHLGLLKAKLAKYRSQLLEPSKKGEKGDGFDVLKSGDAR------- 63
            |:|..:...||...:...:.::.|||...:.||.:.|   ||...|....::|...:.       
  Fly    93 KLALGQLNTARHLVDNVAKDYVRLLKYGDSLYRCKQL---KKAALGRMATIMKRQASNLTYLEQV 154

  Fly    64 ----------------VALIGFPSVGKSTMLSTLTKTESEAANYEFTTLTCIPGVIEYQGANIQL 112
                            :.:.|||:||||:.::.:|:.:.|...|.|||.:...|..:|:....|:
  Fly   155 RQHLSRLPTIDPYSRTIIICGFPNVGKSSFINKITRADVEVQPYAFTTKSLYVGHTDYKYLRWQV 219

  Fly   113 LDLPGIIEGAAQGKG--RGRQVIAVARTADLVLMMLDATKPNVHRELLERELESVGIRLNKRKPN 175
            :|.|||::...:.:.  ..:.:.|:|.....||..:|.::                         
  Fly   220 IDTPGILDHPLEERNVIEMQAITALAHLRACVLYFMDISE------------------------- 259

  Fly   176 IYFKQKKGGGLSFNATCSLTRCNEKMVQTILHSFKIFNAEVLFREDCTEDEFIDVVTANRVYLPC 240
                                :|...:.:.:    |:|             |.|..:..|:   |.
  Fly   260 --------------------QCGHSLEEQV----KLF-------------ESIKPLFTNK---PL 284

  Fly   241 LYVYNKIDQISIEEVDRLARQPNSIVVSCNMKLNLDYM----------MEALWEALQLIRVY--- 292
            :...||||.::.|:   |..:..:|:.......|:..|          ||...||.:.:..|   
  Fly   285 ILAINKIDILTPED---LPEERRAIITKLQEDKNIPVMLMSTVQETGVMEVKTEACERLLSYRVD 346

  Fly   293 ----TKKPGAPPDFDDGLILRKGVSVEHVCHAIHRTLAA 327
                |||                  |:::.:.:|..:.|
  Fly   347 QKMRTKK------------------VDNILNRLHVAMPA 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6195NP_650822.1 Rbg1 1..363 CDD:224085 66/364 (18%)
Non1NP_001286247.1 Nog1 5..341 CDD:224009 59/318 (19%)
NOG 169..341 CDD:206684 45/239 (19%)
NOGCT 398..448 CDD:285381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452764
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.