DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6195 and CG10628

DIOPT Version :9

Sequence 1:NP_650822.1 Gene:CG6195 / 42343 FlyBaseID:FBgn0038723 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_609999.2 Gene:CG10628 / 35263 FlyBaseID:FBgn0032818 Length:383 Species:Drosophila melanogaster


Alignment Length:163 Identity:52/163 - (31%)
Similarity:78/163 - (47%) Gaps:24/163 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 ARVALIGFPSVGKSTMLSTLTKTESEAANYEFTTLTCIPGVIEYQG-ANIQLLDLPGIIEGAAQG 125
            |.|.|:|||:.||||:|..::..:.:.|.|.|||:....|.|||:. .:|.:.||||:||||...
  Fly   158 ADVGLVGFPNAGKSTLLKAVSNAKPKIAAYPFTTIRPQIGTIEYRDLRSITVADLPGLIEGAHAN 222

  Fly   126 KGRGRQVIA-VARTADLVLMM----LDATKPNVHRE------LLERELESVGIRLNKRKPNIYF- 178
            .|.|.:.:. :.||..||.|:    ...:..:.||:      .|.:|||.....| ..||::.. 
  Fly   223 FGMGHKFLKHIERTRLLVFMVDIFGFQLSPKHPHRDCLANVYALNKELELYDPSL-LEKPSVLLL 286

  Fly   179 -KQKKGGG---------LSFNATCSLTRCNEKM 201
             |..|.|.         |..:....|.:|.|::
  Fly   287 NKMDKEGAHEIFTKVKPLVSDLASGLEQCPEEL 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6195NP_650822.1 Rbg1 1..363 CDD:224085 52/163 (32%)
CG10628NP_609999.2 obgE 24..352 CDD:237048 52/163 (32%)
GTP1_OBG 24..>127 CDD:279370
Obg 158..352 CDD:206685 52/163 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452770
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.