DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6195 and CG13390

DIOPT Version :9

Sequence 1:NP_650822.1 Gene:CG6195 / 42343 FlyBaseID:FBgn0038723 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_609218.1 Gene:CG13390 / 34154 FlyBaseID:FBgn0032031 Length:381 Species:Drosophila melanogaster


Alignment Length:248 Identity:66/248 - (26%)
Similarity:98/248 - (39%) Gaps:78/248 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SKKGEKGDGFDV---LKSGDARVALIGFPSVGKSTMLSTLTKTESEAANYEFTTLTCIPGVIEYQ 106
            |:.|.:|:....   |:| .|.|.|||:|:.||||:|:.||:.:.:.|.|.||||....|.::|.
  Fly   187 SEYGPRGEDLSYTLELRS-MADVGLIGYPNAGKSTLLNALTRAKPKVAPYAFTTLRPHLGTVQYD 250

  Fly   107 G-ANIQLLDLPGIIEGAAQGKGRGRQVIAVARTADLVLMMLDATKPN--VHRELLERELESVGIR 168
            . ..:.:.||||::..|.:.||.|.|.:..|....|:|.:|||:.|.  .|.|.|..||...|.|
  Fly   251 DHVQLTIADLPGLVPDAHRNKGLGIQFLKHAERCTLLLFVLDASAPEPWTHYEQLMHELRQFGGR 315

  Fly   169 LNKRKPNIYFKQKKGGGLSFNATCSLTRCNEKMVQTILHSFKIFNAEVLFREDCTEDEFIDVVTA 233
            |..|                                                             
  Fly   316 LASR------------------------------------------------------------- 319

  Fly   234 NRVYLPCLYVYNKID----QISIEEVDRLARQPNSIVVSCNMKLNLDYMMEAL 282
                 |.|.|.||:|    |.:.||:.|..:.| .:.:|..|..||..::.::
  Fly   320 -----PQLVVANKLDVEEGQNNFEELQRRLQNP-VLGISAKMGHNLGQLLNSI 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6195NP_650822.1 Rbg1 1..363 CDD:224085 66/248 (27%)
CG13390NP_609218.1 Obg_CgtA 52..366 CDD:274271 66/246 (27%)
GTP1_OBG 52..202 CDD:279370 3/14 (21%)
Obg 206..368 CDD:206685 61/228 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452767
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.