DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nup58 and si:ch211-216l23.2

DIOPT Version :9

Sequence 1:NP_650821.2 Gene:Nup58 / 42342 FlyBaseID:FBgn0038722 Length:546 Species:Drosophila melanogaster
Sequence 2:NP_001038534.1 Gene:si:ch211-216l23.2 / 565061 ZFINID:ZDB-GENE-030131-3806 Length:474 Species:Danio rerio


Alignment Length:118 Identity:28/118 - (23%)
Similarity:39/118 - (33%) Gaps:14/118 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TPTTNNAI--GGATAATGAFAFGARPATTTAPPPSFGAATSTPTFGAAPATTSLFAAPAATPAFG 65
            ||:::..:  |.....||.|       ..|.|||........|......|..||.  |:...:..
Zfish   319 TPSSSGDVSSGLQIGLTGTF-------PKTKPPPLLSMQNLKPPSHRLSAPHSLL--PSLAQSSR 374

  Fly    66 APAATPAFGAPASTPGFGATSTAAPAF---GTAAATPAFGIPAATSAFGAPAA 115
            ..||:.....|....|.|:|...||:.   |....||.....::......|.|
Zfish   375 GAAASHGLDKPQPLLGPGSTFVPAPSSARPGGLLDTPLLSFQSSRGLLPHPGA 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nup58NP_650821.2 PHA03247 <25..195 CDD:223021 22/94 (23%)
Nucleoporin_FG2 136..>525 CDD:374260
si:ch211-216l23.2NP_001038534.1 PHA03307 280..>471 CDD:223039 28/118 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0845
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.