DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nup58 and Neos

DIOPT Version :9

Sequence 1:NP_650821.2 Gene:Nup58 / 42342 FlyBaseID:FBgn0038722 Length:546 Species:Drosophila melanogaster
Sequence 2:NP_001261502.1 Gene:Neos / 38795 FlyBaseID:FBgn0024542 Length:371 Species:Drosophila melanogaster


Alignment Length:329 Identity:64/329 - (19%)
Similarity:106/329 - (32%) Gaps:100/329 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 ATTAASLNFNTTTTTATAQPFNTGLKLGTTNA----------TTTLGGGGIFSKPAGQAAAPAAS 282
            |..|||....:|.........|..:|....||          ..|:.||.:.|     |||.||.
  Fly    65 ANKAASALHKSTFKQNMLTVRNASIKSKAANAIAKRNSNQGGQVTVQGGLVMS-----AAAAAAG 124

  Fly   283 TFVGLGGIDVTATQPKLGD-----NKQDGIKIKETQVPDEIIKTVDGLKAYIKQQKTISS---DI 339
                         ||.:.|     ..::..|..|                ||:::...||   |:
  Fly   125 -------------QPLINDCEIIVQNRENTKYAE----------------YIEERLKNSSLRVDV 160

  Fly   340 GRTSTSKFTNVSHEITNLKWALQNM-------ATLVEGSNQQIRLMRQETVKAIQSLEMAQRTQD 397
                  .|.|   |...|...|.|:       |.||...:::...:   ||..:..:....|   
  Fly   161 ------LFPN---EDVLLGKVLANISSRGCLYAVLVTPQHEEHNSI---TVNILYGVPAEHR--- 210

  Fly   398 TPAGLQFENNAPFQYFQCLVAKYEQDLIAFRQQIALTERHMHAISNPQSISPDDLKRGFRQLNES 462
                     |.|.:....|::   .|....:|:.|:......:|...|...|.:::....:|.::
  Fly   211 ---------NMPLEDAITLIS---TDFRLKKQRDAVVLPPSTSIHKGQRRHPQEMQGLLERLADN 263

  Fly   463 FISLAGRLHEVHQRVEEHKEHYLNLRRYRLRDTTNVFERIDNPPLPTVEPQRISSGPTPFSNISA 527
            ....|.:...:.:.:|..:|..|.    |.....|...::..|. |.:|.|:         .|.:
  Fly   264 HPLTASQYEVILKYLEGEREEQLK----REVGEANALAKLKAPD-PEIELQK---------KILS 314

  Fly   528 LMNK 531
            :|||
  Fly   315 IMNK 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nup58NP_650821.2 PHA03247 <25..195 CDD:223021
Nucleoporin_FG2 136..>525 CDD:374260 60/321 (19%)
NeosNP_001261502.1 U2AF_lg <19..149 CDD:273727 25/117 (21%)
RRM_SF 20..78 CDD:388407 5/12 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0845
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.