DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nup58 and CG8086

DIOPT Version :9

Sequence 1:NP_650821.2 Gene:Nup58 / 42342 FlyBaseID:FBgn0038722 Length:546 Species:Drosophila melanogaster
Sequence 2:NP_001260237.1 Gene:CG8086 / 34131 FlyBaseID:FBgn0032010 Length:1603 Species:Drosophila melanogaster


Alignment Length:630 Identity:133/630 - (21%)
Similarity:183/630 - (29%) Gaps:274/630 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FTPT------TNNAIGGATAATG-------------AFAFGAR-----PATTTAP---------- 32
            :||:      .|..:...|.|.|             ||:|..|     |:.|.||          
  Fly  1007 YTPSFTFAGKNNPKVENDTPAPGDYHPEKVRQDHNPAFSFAGRHDLHKPSDTPAPGAYSPEKVRQ 1071

  Fly    33 --PPSFGAA--------TSTPTFG-AAPATTSLFAAPAATPAFG----------APAA------- 69
              .|:|..|        ..||..| ..|....|...||.|  ||          .||.       
  Fly  1072 DHNPAFSMAGKYIEKITNGTPAPGDYCPEKVRLDHTPAFT--FGGKNDPKVENNTPAPGDYHPEK 1134

  Fly    70 -----TPAFG--------APASTPGFGATSTAA------PAFGTAAA--------TPAFG----- 102
                 .|||.        .|..||..||.|...      |||..|..        |||.|     
  Fly  1135 VRQDHVPAFSFAGRHDLHKPNETPAPGAYSPEKVRQDHNPAFTMAGKHDPKVTHDTPAPGDYHPE 1199

  Fly   103 ------IPAATSA----FGAPAATPAFG------------------------AAAATPAFG---- 129
                  .||.:.|    ...|:.|||.|                        :.:.:||.|    
  Fly  1200 KVRLDHNPAFSFAGRHDLHKPSETPAPGDYFPEKVRQDFNPAFTFAGKHDPRSLSESPAPGDYSP 1264

  Fly   130 -------APAATPAFG--------------------------APAATSAFGAPAATTAFGAPA-- 159
                   |||.  :||                          .||.|.| |.|||......||  
  Fly  1265 EKVRLDHAPAF--SFGGKHDPKTEHLHPAPCDYAPEKVRLDHTPAYTIA-GRPAADHVSQTPAPC 1326

  Fly   160 ----------STQASAFG----------APAPAVGT-------VAPTFSFATPA-----TSAPTT 192
                      ||.|..||          .|||:...       ..|.:||.|.:     |.||  
  Fly  1327 DYHPEQCQVDSTPAFTFGMRLGRERISDTPAPSAYEPEKHSLHSTPAYSFGTKSDIRVTTDAP-- 1389

  Fly   193 AP-------------PAFGFGTTATTAAAAMPASLSSGIGSFSFPKPQATTAASLNFNTTTTTAT 244
            ||             ||:.|| ..|...|::|....:.|......:.:...|:.:..|...||.|
  Fly  1390 APGHYHPEQCKLDSSPAYSFG-LKTVPTASLPEPRGAYIEDRIVQRRERRLASPVRNNAECTTTT 1453

  Fly   245 AQPFNTGLKLGTTNATTTLGGGGIFSKPAGQAAAPAASTFVGLGGIDVTATQPKLGDNKQDGI-- 307
            ....|......||..|||               .....||:  .|::....|.|....:.:|.  
  Fly  1454 TNHTNNNAGSSTTTTTTT---------------TTTTKTFI--NGVEQPELQKKETTKQVNGTHK 1501

  Fly   308 KIKET-QVP------------DEIIKTVDGLKAYIKQQ------KTISSDIGRTSTSKFTNVSHE 353
            ::|.. |.|            .:::.|...::.....|      |.::|.....|.:|...|||:
  Fly  1502 ELKSAPQAPLSNGNIVSNGNHSKMVSTTTRIQEVAHGQKESGNLKVVASGKSDASATKAAAVSHQ 1566

  Fly   354 ITNLKWALQNMATLVEGSNQQI---RLMRQETVK-AIQSLEMAQR 394
                        |:|:.....:   :..|.:||| |:::..:.::
  Fly  1567 ------------TVVQADGAIVTSGQSSRMQTVKYAVEASSVQEK 1599

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nup58NP_650821.2 PHA03247 <25..195 CDD:223021 80/362 (22%)
Nucleoporin_FG2 136..>525 CDD:374260 73/357 (20%)
CG8086NP_001260237.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R852
SonicParanoid 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.