DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nup58 and Nup62cl

DIOPT Version :9

Sequence 1:NP_650821.2 Gene:Nup58 / 42342 FlyBaseID:FBgn0038722 Length:546 Species:Drosophila melanogaster
Sequence 2:NP_001075137.1 Gene:Nup62cl / 279706 MGIID:2685565 Length:272 Species:Mus musculus


Alignment Length:315 Identity:60/315 - (19%)
Similarity:108/315 - (34%) Gaps:112/315 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 FPK----PQATTAASLNFNTTTTTATAQPFNTGLKLGTTNATTTLGGG-GIFSKPAGQAAAPAAS 282
            ||.    |.:..:..|:..|:|||.|..         |||.|||:..| .::.:|      ||:.
Mouse     2 FPSMPYVPASMASQELSSTTSTTTTTTV---------TTNTTTTITSGFNLYVRP------PASP 51

  Fly   283 TFVGLGGIDVTATQPKLGDNKQDGIKIKETQVPDEIIKTV------------------DGLKAYI 329
            .....|.|:| |:.|             .|...:.|:..|                  :..|.|.
Mouse    52 WLNNTGLINV-ASMP-------------STMTVNSIVTPVMTYGPLESMANNWHYQLQEQEKHYF 102

  Fly   330 KQQKTISSDIGRTSTSKFTNVSHEITNLKWALQNMATLVEGSNQ--------------QIRLMRQ 380
            .|..                        ::.|.|.| |:|..|:              |.||.::
Mouse   103 YQAN------------------------QFNLWNQA-LIESGNEIALLYNEVERVKIDQSRLEQE 142

  Fly   381 ETVKAIQSLEMAQ---------RTQDTPAGLQFENNAPFQYFQCLVAKYEQDLIAFRQQIALTER 436
            ..:...|..|:.|         :.|:.|..:.:.|. .::....|....:.:|....|.:.....
Mouse   143 LDIILFQQKELEQMLTPIEELLKEQNGPLNMMYVNK-EYEMIYRLAEIIDAELKRMSQDLKDIVV 206

  Fly   437 HMHAISNPQSISPDDLKRGFRQLNESFISL------AG----RLHEVHQRVEEHK 481
            :::::::|.. :.:.|::..:.||....||      :|    ::.||...|||::
Mouse   207 YLNSLAHPAD-ATEQLEQICKILNAHMESLQWINLNSGVMQKKVEEVANAVEEYR 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nup58NP_650821.2 PHA03247 <25..195 CDD:223021
Nucleoporin_FG2 136..>525 CDD:374260 60/315 (19%)
Nup62clNP_001075137.1 Nsp1_C 65..179 CDD:368271 22/152 (14%)
SMC_prok_B <105..>266 CDD:274008 30/183 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R852
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.