DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha13 and ATP6V1G1

DIOPT Version :9

Sequence 1:NP_001287407.1 Gene:Vha13 / 42341 FlyBaseID:FBgn0283536 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_004879.1 Gene:ATP6V1G1 / 9550 HGNCID:864 Length:118 Species:Homo sapiens


Alignment Length:114 Identity:57/114 - (50%)
Similarity:82/114 - (71%) Gaps:0/114 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASQTQGIQQLLAAEKKAAEKVAEARKRKARRLKQAKDEATEEIEKFRQERERAFKEFEAKHMGS 65
            ||||:|||||||.|||:|||||:||||||.|||||||:||..|||::|.:||:.||..||..:||
Human     1 MASQSQGIQQLLQAEKRAAEKVSEARKRKNRRLKQAKEEAQAEIEQYRLQREKEFKAKEAAALGS 65

  Fly    66 REGVAAKIDADIRVKLADMDRAIQTRKDPFILEILQYVYNISPEVHKNY 114
            |...:.:::.:.:.|:..:....:..:|..:..:|.:|.:|.||:|:||
Human    66 RGSCSTEVEKETQEKMTILQTYFRQNRDEVLDNLLAFVCDIRPEIHENY 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha13NP_001287407.1 V-ATPase_G 3..107 CDD:397340 49/103 (48%)
ATP6V1G1NP_004879.1 V_ATP_synt_G 1..113 CDD:130217 55/111 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 97 1.000 Domainoid score I7262
eggNOG 1 0.900 - - E1_KOG1772
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 114 1.000 Inparanoid score I4838
Isobase 1 0.950 - 0 Normalized mean entropy S846
OMA 1 1.010 - - QHG53999
OrthoDB 1 1.010 - - D1566576at2759
OrthoFinder 1 1.000 - - FOG0001911
OrthoInspector 1 1.000 - - otm40812
orthoMCL 1 0.900 - - OOG6_101449
Panther 1 1.100 - - LDO PTHR12713
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1634
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.820

Return to query results.
Submit another query.