DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha13 and VATG3

DIOPT Version :9

Sequence 1:NP_001287407.1 Gene:Vha13 / 42341 FlyBaseID:FBgn0283536 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_194325.1 Gene:VATG3 / 828701 AraportID:AT4G25950 Length:108 Species:Arabidopsis thaliana


Alignment Length:98 Identity:32/98 - (32%)
Similarity:58/98 - (59%) Gaps:4/98 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GIQQLLAAEKKAAEKVAEARKRKARRLKQAKDEATEEIEKFRQERERAFKEFEAKHMGS-REGVA 70
            |||.||.||::|...|:.||..|..|:|||||||.:|:|::|...|   :|::.:..|: :|..|
plant     9 GIQMLLTAEQEAGRIVSAARTAKLARMKQAKDEAEKEMEEYRSRLE---EEYQTQVSGTDQEADA 70

  Fly    71 AKIDADIRVKLADMDRAIQTRKDPFILEILQYV 103
            .::|.:..|::.::..:........:..:::||
plant    71 KRLDDETDVRITNLKESSSKVSKDIVKMLIKYV 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha13NP_001287407.1 V-ATPase_G 3..107 CDD:397340 32/98 (33%)
VATG3NP_194325.1 V-ATPase_G 5..105 CDD:281210 32/98 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 56 1.000 Domainoid score I4044
eggNOG 1 0.900 - - E1_KOG1772
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2589
OMA 1 1.010 - - QHG53999
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto3195
orthoMCL 1 0.900 - - OOG6_101449
Panther 1 1.100 - - O PTHR12713
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.830

Return to query results.
Submit another query.