DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha13 and VMA10

DIOPT Version :9

Sequence 1:NP_001287407.1 Gene:Vha13 / 42341 FlyBaseID:FBgn0283536 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_001327894.1 Gene:VMA10 / 821130 AraportID:AT3G01390 Length:110 Species:Arabidopsis thaliana


Alignment Length:101 Identity:34/101 - (33%)
Similarity:58/101 - (57%) Gaps:4/101 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASQTQG-IQQLLAAEKKAAEKVAEARKRKARRLKQAKDEATEEIEKFRQERERAFKEFEAKHMGS 65
            :::.|| ||||||||.:|...|..||..|..||||||:||.:||.:::.:.|:.|:....:..|.
plant     3 SNRGQGSIQQLLAAEVEAQHIVNAARTAKMARLKQAKEEAEKEIAEYKAQTEQDFQRKLEETSGD 67

  Fly    66 REGVAAKIDADIRVKLADM-DRAIQTRKDPFILEIL 100
            ......:::.:...|:..: :.|.:..||  ::|:|
plant    68 SGANVKRLEQETDTKIEQLKNEASRISKD--VVEML 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha13NP_001287407.1 V-ATPase_G 3..107 CDD:397340 34/100 (34%)
VMA10NP_001327894.1 V-ATPase_G 5..109 CDD:397340 34/99 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 56 1.000 Domainoid score I4044
eggNOG 1 0.900 - - E1_KOG1772
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2589
OMA 1 1.010 - - QHG53999
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101449
Panther 1 1.100 - - O PTHR12713
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.830

Return to query results.
Submit another query.