DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha13 and Atp6v1g2

DIOPT Version :9

Sequence 1:NP_001287407.1 Gene:Vha13 / 42341 FlyBaseID:FBgn0283536 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_997655.1 Gene:Atp6v1g2 / 368044 RGDID:1303186 Length:118 Species:Rattus norvegicus


Alignment Length:114 Identity:56/114 - (49%)
Similarity:84/114 - (73%) Gaps:0/114 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASQTQGIQQLLAAEKKAAEKVAEARKRKARRLKQAKDEATEEIEKFRQERERAFKEFEAKHMGS 65
            ||||:|||||||.|||:||||||:|||||||||||||:||..|:|::|:|||:.|:..:...|||
  Rat     1 MASQSQGIQQLLQAEKRAAEKVADARKRKARRLKQAKEEAQMEVEQYRREREQEFQSKQQAAMGS 65

  Fly    66 REGVAAKIDADIRVKLADMDRAIQTRKDPFILEILQYVYNISPEVHKNY 114
            :..::|:::...|.::..|..:.|..::..:.::|..|.::.|:||.||
  Rat    66 QGNLSAEVEQATRRQVQGMQSSQQRNRERVLTQLLGMVCDVRPQVHPNY 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha13NP_001287407.1 V-ATPase_G 3..107 CDD:397340 49/103 (48%)
Atp6v1g2NP_997655.1 V-ATPase_G 3..107 CDD:397340 49/103 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348886
Domainoid 1 1.000 96 1.000 Domainoid score I7131
eggNOG 1 0.900 - - E1_KOG1772
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41518
Inparanoid 1 1.050 113 1.000 Inparanoid score I4753
OMA 1 1.010 - - QHG53999
OrthoDB 1 1.010 - - D1566576at2759
OrthoFinder 1 1.000 - - FOG0001911
OrthoInspector 1 1.000 - - otm44955
orthoMCL 1 0.900 - - OOG6_101449
Panther 1 1.100 - - O PTHR12713
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.770

Return to query results.
Submit another query.