DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha13 and Atp6v1g3

DIOPT Version :9

Sequence 1:NP_001287407.1 Gene:Vha13 / 42341 FlyBaseID:FBgn0283536 Length:117 Species:Drosophila melanogaster
Sequence 2:XP_017454249.1 Gene:Atp6v1g3 / 289407 RGDID:1304635 Length:167 Species:Rattus norvegicus


Alignment Length:126 Identity:47/126 - (37%)
Similarity:76/126 - (60%) Gaps:12/126 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASQTQGIQQLLAAEKKAAEKVAEARKRKARRLKQAKDEATEEIEKFRQERERAFKEFEAK---- 61
            |.||:|||||||.|||:|.:|:.||:|||.:||:|||:||..|.:::|.:||:.|:..::|    
  Rat    38 MTSQSQGIQQLLQAEKRAKDKLDEAKKRKGKRLRQAKEEAVAETDQYRMQREKEFRLKQSKVRNT 102

  Fly    62 --------HMGSREGVAAKIDADIRVKLADMDRAIQTRKDPFILEILQYVYNISPEVHKNY 114
                    .|||:..::.:::.....|:.::..:.....|..|.::|..|..:.||||.||
  Rat   103 AAPPPGTQIMGSQSHLSDELEEQTLEKIKELSGSYHKCMDSVIKQLLSMVCEMKPEVHVNY 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha13NP_001287407.1 V-ATPase_G 3..107 CDD:397340 40/115 (35%)
Atp6v1g3XP_017454249.1 V-ATPase_G 40..156 CDD:281210 40/115 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I7131
eggNOG 1 0.900 - - E1_KOG1772
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4753
OMA 1 1.010 - - QHG53999
OrthoDB 1 1.010 - - D1566576at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44955
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12713
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.940

Return to query results.
Submit another query.