DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha13 and vha-10

DIOPT Version :9

Sequence 1:NP_001287407.1 Gene:Vha13 / 42341 FlyBaseID:FBgn0283536 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_491641.1 Gene:vha-10 / 172216 WormBaseID:WBGene00006919 Length:126 Species:Caenorhabditis elegans


Alignment Length:113 Identity:59/113 - (52%)
Similarity:83/113 - (73%) Gaps:0/113 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASQTQGIQQLLAAEKKAAEKVAEARKRKARRLKQAKDEATEEIEKFRQERERAFKEFEAKHMGS 65
            ||||||||||||||||:||||:.||||||.:|.||||.||..|:||::|:||..||.||.:::|:
 Worm     1 MASQTQGIQQLLAAEKRAAEKINEARKRKLQRTKQAKQEAQAEVEKYKQQREAEFKAFEQQYLGT 65

  Fly    66 REGVAAKIDADIRVKLADMDRAIQTRKDPFILEILQYVYNISPEVHKN 113
            :|.:.:||..|...:::.|.:::...|...|:.:||.|.:|.||:|.|
 Worm    66 KEDIESKIRRDTEDQISGMKQSVAGNKQAVIVRLLQLVCDIKPELHHN 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha13NP_001287407.1 V-ATPase_G 3..107 CDD:397340 52/103 (50%)
vha-10NP_491641.1 V_ATP_synt_G 1..113 CDD:130217 58/111 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163628
Domainoid 1 1.000 107 1.000 Domainoid score I4085
eggNOG 1 0.900 - - E1_KOG1772
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 121 1.000 Inparanoid score I3331
Isobase 1 0.950 - 0 Normalized mean entropy S846
OMA 1 1.010 - - QHG53999
OrthoDB 1 1.010 - - D1566576at2759
OrthoFinder 1 1.000 - - FOG0001911
OrthoInspector 1 1.000 - - oto20597
orthoMCL 1 0.900 - - OOG6_101449
Panther 1 1.100 - - LDO PTHR12713
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1634
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.