DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha13 and atp6v1g3

DIOPT Version :9

Sequence 1:NP_001287407.1 Gene:Vha13 / 42341 FlyBaseID:FBgn0283536 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_001096517.1 Gene:atp6v1g3 / 100125150 XenbaseID:XB-GENE-949366 Length:118 Species:Xenopus tropicalis


Alignment Length:117 Identity:51/117 - (43%)
Similarity:78/117 - (66%) Gaps:0/117 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASQTQGIQQLLAAEKKAAEKVAEARKRKARRLKQAKDEATEEIEKFRQERERAFKEFEAKHMGS 65
            ||||:|||||||.|||:|.:|:.||:|||.:||:|||:|||.:|:::|.:||..|:..:...|||
 Frog     1 MASQSQGIQQLLQAEKRAKDKLEEAKKRKNKRLRQAKEEATADIDQYRLKREGDFRRIQTSVMGS 65

  Fly    66 REGVAAKIDADIRVKLADMDRAIQTRKDPFILEILQYVYNISPEVHKNYNHK 117
            :..:|.||:.....|:.....:....|:..:.::|...|||.||:|.|:.:|
 Frog    66 QGNLAVKIEEQTVEKIQLYSSSFHKYKEGVLQQLLDLAYNIKPELHTNFQYK 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha13NP_001287407.1 V-ATPase_G 3..107 CDD:397340 43/103 (42%)
atp6v1g3NP_001096517.1 V-ATPase_G 3..107 CDD:308679 43/103 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 89 1.000 Domainoid score I7732
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 106 1.000 Inparanoid score I4796
OMA 1 1.010 - - QHG53999
OrthoDB 1 1.010 - - D1566576at2759
OrthoFinder 1 1.000 - - FOG0001911
OrthoInspector 1 1.000 - - otm48008
Panther 1 1.100 - - O PTHR12713
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1634
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.110

Return to query results.
Submit another query.