DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment subdued and F56A8.9

DIOPT Version :9

Sequence 1:NP_001189248.1 Gene:subdued / 42340 FlyBaseID:FBgn0038721 Length:1099 Species:Drosophila melanogaster
Sequence 2:NP_001255192.1 Gene:F56A8.9 / 13191724 WormBaseID:WBGene00185001 Length:233 Species:Caenorhabditis elegans


Alignment Length:178 Identity:41/178 - (23%)
Similarity:72/178 - (40%) Gaps:37/178 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 HNLHERLTGKESFWRGRDTSQRFLDQEQLSASRESLGAADKRARFAESNAPTLQ--LPESAEPRA 128
            |..|::|. .|||      .||.::......|.:.:| .|||..|.|.....:|  |.||.|   
 Worm    47 HIDHKKLF-TESF------KQRRIEHTTAIESIKKIG-KDKRRLFLEDVLKNVQNLLKESRE--- 100

  Fly   129 NGKRPTGNRTNPSNPAAPLLPMTDPDFVKGNVGGVYDDRECSCPREFYQRGEINTSLFFEDCV-- 191
             ....|.:|::...|..       .:.:|..:..::::      ..|:....:..|.|||..:  
 Worm   101 -ALERTAHRSDSPFPHG-------SELLKDALSKLHEN------IAFFTDLSLAFSKFFETKIQK 151

  Fly   192 -RSIDFVLAYRINAHEPTEL--ENTEKRRVFEANLISQGLE-VESSQK 235
             |.:..::.:..|....|.:  |.|||:    ..|::|..| :|.::|
 Worm   152 DRKLKTLIVWAYNYSIKTGIFDEETEKK----VQLMAQQHEFIEKNEK 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
subduedNP_001189248.1 Anoct_dimer 186..428 CDD:292796 15/56 (27%)
Anoctamin 431..1007 CDD:282414
F56A8.9NP_001255192.1 ERK-JNK_inhib 40..220 CDD:291663 41/178 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2514
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.