DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6231 and GIT1

DIOPT Version :9

Sequence 1:NP_001262734.1 Gene:CG6231 / 42339 FlyBaseID:FBgn0038720 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_010022.1 Gene:GIT1 / 850462 SGDID:S000000695 Length:518 Species:Saccharomyces cerevisiae


Alignment Length:242 Identity:51/242 - (21%)
Similarity:82/242 - (33%) Gaps:71/242 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 CEKWIYNYDF-----GYRSMNTELNWVCDSAYKARIGQSLFFIG--SVVGTLFYGLLSDKIGRVP 149
            |..| :.|||     |..|.....:.:.|.....::.:....:|  :|:|......|||:|||..
Yeast   273 CGTW-FMYDFVTFPNGIFSSTIISSVIKDQNDLVKVAEWNLLLGVLAVLGVPIGAYLSDRIGRKY 336

  Fly   150 ALILSNFCGFAGDFSTIFTKSVATFTLCRFISGLAADTNFYLMYIIVLEYIRPSMRTLG------ 208
            .|:.    ||:|            :.:...|.|.|.|....:..:.::.|  ..|..||      
Yeast   337 TLMF----GFSG------------YIIFGLIIGCAYDQLKKITPLFIIFY--AFMNMLGNAGPGD 383

  Fly   209 ----------LNMAVGLFYCLGLV------------FTPWLAVLVGHWQIYLACTSLPILLVVLY 251
                      .....|:||.|..|            |.|....|...|...:|.....|.:::.|
Yeast   384 MLGVISSEASATAVRGVFYGLSAVTGKIGSVVGVECFQPIRDNLGARWTFIIAAICGLIGIIITY 448

  Fly   252 YFVVQESAQWLVTRNDIDGAIVRLKRVAKFNGCRVS-----QADFDE 293
            :||...      ..:|:      :|:..:|:...||     :..|||
Yeast   449 FFVPHS------LESDL------MKQDVEFHNYLVSNGWTGKMGFDE 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6231NP_001262734.1 2A0119 11..509 CDD:273328 51/242 (21%)
MFS 125..499 CDD:119392 43/204 (21%)
GIT1NP_010022.1 MFS_PhT 48..454 CDD:340922 43/199 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.