DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6231 and CG33233

DIOPT Version :9

Sequence 1:NP_001262734.1 Gene:CG6231 / 42339 FlyBaseID:FBgn0038720 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster


Alignment Length:320 Identity:73/320 - (22%)
Similarity:116/320 - (36%) Gaps:99/320 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 WIYNYDF------GYRSMNTELNWVCDSAYKARIGQSLFFIGSVVGTLFYGLLSDKIGR------ 147
            :||.|..      ||..:.|...:......|..:..||.. |.|...||.|.|:|:.||      
  Fly    28 FIYMYSVTESMTAGYLVVLTSCEFDTSPKEKTLLANSLLG-GMVASGLFIGFLADRYGRKFVIRL 91

  Fly   148 ----------------------VPALILSNF--------CGFAGDFSTIFTKSVATFTLCRFISG 182
                                  |..:|:..|        .||.|:|..|..:.: |..:|....|
  Fly    92 ALVGALSFSVISALMPDLYSLSVIRIIVGTFLSAVASLQVGFLGEFHAIKWRPI-TVAICSQSQG 155

  Fly   183 LAADTNFYLMYI-IVLEYIRPSMRTLGL----NMAVGLFYCLGLVFTPWLAVLVGHWQIYLACTS 242
            ||      |:|. :|...|.|:...:.|    |:.|..|..:..:...||| |||      .|  
  Fly   156 LA------LIYCPLVAMAILPNNFNVDLSSSYNLRVWRFLMMFFMIPGWLA-LVG------IC-- 205

  Fly   243 LPILLVVLYYFVVQESAQWLVTRNDIDGAIVRLKRVAKFNGCRVSQADFDEFRRHCQMTHEMLGG 307
                       :|.|:..:|::.|..|.|::.||.:.:.|  |....|.|     ..::.|....
  Fly   206 -----------LVPETPHFLMSVNRPDKALLALKWICRMN--RKKWEDVD-----ITLSEEKSST 252

  Fly   308 DDKK--------QATLLDMFRTPRMRKNTLIL------FFKSMVITLCYDAVSRNVEGMG 353
            :|::        :..||  |..|.:.|..:.|      ||.|:.:.:.:..: ||::..|
  Fly   253 NDQEGFWKTVWYEYKLL--FSKPHVFKFFICLFLIFGIFFTSIGLGIWFPVI-RNMDNSG 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6231NP_001262734.1 2A0119 11..509 CDD:273328 73/320 (23%)
MFS 125..499 CDD:119392 66/284 (23%)
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 73/320 (23%)
MFS 23..>208 CDD:119392 47/207 (23%)
MFS 354..>482 CDD:304372
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458225
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.