DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6231 and T05A1.5

DIOPT Version :9

Sequence 1:NP_001262734.1 Gene:CG6231 / 42339 FlyBaseID:FBgn0038720 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001366751.1 Gene:T05A1.5 / 188077 WormBaseID:WBGene00011456 Length:359 Species:Caenorhabditis elegans


Alignment Length:227 Identity:49/227 - (21%)
Similarity:92/227 - (40%) Gaps:18/227 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 SLFFIGSVVGTLFYGLLSDKIGRVPALILSNFCGFAGDFSTIFTKSVATFTLCRFISGLAADTNF 189
            |:||:|:.:....|.:.:|:|||.|.||.|.|..........:..:.....:.||..|.......
 Worm   142 SIFFLGNGILGQIYAVAADRIGRRPVLIASLFISGLSGIGAAYAPTFEIMLIGRFFQGSCFTALT 206

  Fly   190 YLMYIIVLEYIRPSMRTLGLNMAVGLFYCLGLVFTPWLAVLVGHWQIYLACTSLP-ILLVVLYYF 253
            .:.:::..|.|..|..... ::..||.:.:|......||:....|:.....||:| :|..:|..|
 Worm   207 MINWVMCCESISFSGHGYA-SVLFGLCWVIGYCSVSPLAMYFSTWRYVQLATSVPCVLFGILMMF 270

  Fly   254 VVQESAQWLVTRNDIDGAIVRLKRVAKFNGCRVSQADFDEFRRHCQMTHEMLGGDDKKQA---TL 315
            .:.||..:||.:...|..:..::..::...   .:.|:|     .....:|...::..::   ||
 Worm   271 TLPESFSFLVAKRKRDDLVKWIEMASRVGN---EEIDYD-----ADQIVDMSSREEDNESLLQTL 327

  Fly   316 LDMFRTPRMRKNTLI-----LFFKSMVITLCY 342
            ..:.::..|..||.:     .||..:...|.|
 Worm   328 KLVLQSKLMVTNTAVETFLWKFFDKIFTILKY 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6231NP_001262734.1 2A0119 11..509 CDD:273328 49/227 (22%)
MFS 125..499 CDD:119392 49/227 (22%)
T05A1.5NP_001366751.1 MFS 117..>271 CDD:421695 31/129 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163079
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.