DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17752 and CG33233

DIOPT Version :9

Sequence 1:NP_650817.1 Gene:CG17752 / 42337 FlyBaseID:FBgn0038718 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster


Alignment Length:428 Identity:88/428 - (20%)
Similarity:148/428 - (34%) Gaps:118/428 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 SNYESITTELEWVCDDAYKLAVGQSFFFIGSALGS-IFFGYLADRIGRLPACVLSTLTGASGDFF 155
            :.|..:.|..|:......|..:..|  .:|..:.| :|.|:||||.||.....|:.:...|....
  Fly    40 AGYLVVLTSCEFDTSPKEKTLLANS--LLGGMVASGLFIGFLADRYGRKFVIRLALVGALSFSVI 102

  Fly   156 TSFVGSLPMFSFTRFISGLSMDTQYVLMYILVFEYLSPQHRTFGLNIILGVFYSIGLMISPWIAI 220
            ::.:..|...|..|.|.|..:.....|....:.|:.:.:.|...: .|......:.|:..|.:|:
  Fly   103 SALMPDLYSLSVIRIIVGTFLSAVASLQVGFLGEFHAIKWRPITV-AICSQSQGLALIYCPLVAM 166

  Fly   221 W---------------LGNWRSYLWAASLPALGMLIFPLFLHESVEWLLTKGKFDKAVNNLKSVA 270
            .               |..||..:....:|....|:....:.|:..:|::..:.|||:..||.:.
  Fly   167 AILPNNFNVDLSSSYNLRVWRFLMMFFMIPGWLALVGICLVPETPHFLMSVNRPDKALLALKWIC 231

  Fly   271 KFNGRQVEDSVFDEFIKHYREKLNSAQKKSSDTFMGMLRT-----------PRLRKFTIILLI-- 322
            :.|.::.||.          :...|.:|.|::...|..:|           |.:.||.|.|.:  
  Fly   232 RMNRKKWEDV----------DITLSEEKSSTNDQEGFWKTVWYEYKLLFSKPHVFKFFICLFLIF 286

  Fly   323 ----KSMIITIAFDILSRNVEGVG---------------------------------------IS 344
                .|:.:.|.|.:: ||::..|                                       |.
  Fly   287 GIFFTSIGLGIWFPVI-RNMDNSGSNRLCDLVNNNPTFINHEADDTNGTDSESPKCNDEMTNLID 350

  Fly   345 P-FKLFSYSGFVVLPG----------------------GLSI-ILFQNKIGRKGMACASLLVGAF 385
            | :..|:|.|..:|..                      |:|: |:.|..:.........:|.|..
  Fly   351 PVYYGFTYIGCFILASVLVHWMTRKYVIALHILISMILGISLNIMKQPTVVLIFFVLMMVLPGVL 415

  Fly   386 ITATTGYLVGTLDPANYSVLLGFMVC----LARFGAVV 419
            |...|..||..| |.|   |.|..:|    |||||.|:
  Fly   416 IPLATSVLVDCL-PVN---LRGKALCMVRSLARFGGVL 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17752NP_650817.1 2A0119 11..498 CDD:273328 88/428 (21%)
MFS 116..488 CDD:119392 84/404 (21%)
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 88/428 (21%)
MFS 23..>208 CDD:119392 34/170 (20%)
MFS 354..>482 CDD:304372 26/100 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458229
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.