DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17751 and SLC22A6

DIOPT Version :9

Sequence 1:NP_650816.3 Gene:CG17751 / 42336 FlyBaseID:FBgn0038717 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_004781.2 Gene:SLC22A6 / 9356 HGNCID:10970 Length:563 Species:Homo sapiens


Alignment Length:556 Identity:130/556 - (23%)
Similarity:227/556 - (40%) Gaps:62/556 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDLQSVLEKCGNFGPYQILLLGLFGYTNIVSSLHYFSQTIISFTPSHRCS--------------- 50
            |....:|::.|..|.:|.:.:.|.....::.:.|...|...:..|:|.|.               
Human     1 MAFNDLLQQVGGVGRFQQIQVTLVVLPLLLMASHNTLQNFTAAIPTHHCRPPADANLSKNGGLEV 65

  Fly    51 -RPEDYQPNSTSLLSCSVMQFDKEF-------------KCT-SWDFERESNYESITTELEWVCDD 100
             .|.|.|....|.|..:..|:...|             .|| .|.::..:...:|.||.:.||..
Human    66 WLPRDRQGQPESCLRFTSPQWGLPFLNGTEANGTGATEPCTDGWIYDNSTFPSTIVTEWDLVCSH 130

  Fly   101 AYKLAVGQSFFFIGSALGSIFFGYLADRIGRLPACVLSTLTGASGDFFTSFVGSLPWFSFTRFIS 165
            .....:.||.:.:|..||::.|||||||:||....:|:.|..|......:|..:.|.:...|.:|
Human   131 RALRQLAQSLYMVGVLLGAMVFGYLADRLGRRKVLILNYLQTAVSGTCAAFAPNFPIYCAFRLLS 195

  Fly   166 GLFMDTQYVLMYILVFEYLSPQHRTFGLNIILGVFYCVGLMISPWIAIWVTNWRNYLWAASLPAL 230
            |:.:....:....|..|:: |.|....:..::|..|.:|..:...:|..|.:||:.....|.|..
Human   196 GMALAGISLNCMTLNVEWM-PIHTRACVGTLIGYVYSLGQFLLAGVAYAVPHWRHLQLLVSAPFF 259

  Fly   231 GMLLFPVFLHESAEWLLTKGKFEKAEKSLRGVAKFNGRQVDDSVFDEFIKHYREKLNNS------ 289
            ...::..|..|||.|..:.|:.:...::|:.||:.||::      :|..|...|.|..|      
Human   260 AFFIYSWFFIESARWHSSSGRLDLTLRALQRVARINGKR------EEGAKLSMEVLRASLQKELT 318

  Fly   290 QNKSSDTFMGMLRTPRLRKFTIILLIKSMIITIAFDILSRNVEGVGISPFKLFSYSGFCYLPAGL 354
            ..|...:.|.:||.|.||...:.|.:.....:.|:..|..:::|.|:|.:.:....|...|||.|
Human   319 MGKGQASAMELLRCPTLRHLFLCLSMLWFATSFAYYGLVMDLQGFGVSIYLIQVIFGAVDLPAKL 383

  Fly   355 TIILFQNKIGRKGMACASLFVGAIITAATGYLVATLDPSDYSVLLGFMVSLGRYGAVVAYDAEAQ 419
            ...|..|.:||:....|:|.:..|.....|.:     |.|.|::...:..||:.....:::....
Human   384 VGFLVINSLGRRPAQMAALLLAGICILLNGVI-----PQDQSIVRTSLAVLGKGCLAASFNCIFL 443

  Fly   420 YAAEIIPTSVKGRGVANIHVVGNAFAFFSSYIIYLGTFYKPLPSLMISFILLIGACLCLALPETL 484
            |..|:.||.::..|:.....:....:..|..:......|..:|..:...:.:..:.:.:.|||||
Human   444 YTGELYPTMIRQTGMGMGSTMARVGSIVSPLVSMTAELYPSMPLFIYGAVPVAASAVTVLLPETL 508

  Fly   485 HKNLPQNLEEGEMFAKGEKWYFFPCFSRRPKTQKSA 520
            .:.||..:::.|              ||...|||.|
Human   509 GQPLPDTVQDLE--------------SRWAPTQKEA 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17751NP_650816.3 2A0119 11..490 CDD:273328 120/514 (23%)
MFS 109..481 CDD:119392 89/377 (24%)
SLC22A6NP_004781.2 2A0119 11..515 CDD:273328 121/515 (23%)
MFS 135..505 CDD:119392 90/381 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 525..563 4/6 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153823
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57756
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X24
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.