DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17751 and CG4459

DIOPT Version :9

Sequence 1:NP_650816.3 Gene:CG17751 / 42336 FlyBaseID:FBgn0038717 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_650850.1 Gene:CG4459 / 42377 FlyBaseID:FBgn0038753 Length:632 Species:Drosophila melanogaster


Alignment Length:387 Identity:83/387 - (21%)
Similarity:154/387 - (39%) Gaps:70/387 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 YFSQTIISFTPSH--RCSRPEDYQPNSTSLLSCSVMQFDKEFKCTSWDFERESNYESITTELEWV 97
            |.:.....|..||  ..:..:..:|...|.|.|.             ..|..::|:|:.::.:.:
  Fly   107 YSNSLARGFVRSHGQEWNASQSKEPGGQSSLPCE-------------HVEHRTDYKSLISQFDLI 158

  Fly    98 CDDAYKLAVGQSFFFIGSALGSIFFGYLADRIG--RLPACVLSTLTGASGDFF----TSFVGSLP 156
            |.....:|:.|||..:|:.:|.:.......:|.  ||      .|.|..|..|    |..|.:..
  Fly   159 CSRRVLVALTQSFHALGALIGGLMAYSALKKISPRRL------MLLGMIGQIFCGNLTGLVDTYQ 217

  Fly   157 WFSFTRFISGLFMDTQYVLMYILVFEYLSPQHRTFGLNIILGVFYCVGLMISPWIAIWVTNWRNY 221
            ...:.|.::.:|....|.....::.:..|.:.|...:. :..:|:.:||::.|.|:|:..|| :|
  Fly   218 LHIYFRCLTSIFCALMYTSGQFILNDITSGKARIIVVT-LSELFWSMGLVLLPAISIYFDNW-SY 280

  Fly   222 LWAASLPALGMLLFPVFLH----ESAEWLLTKGKFEKAEKSLRGVAKFNGRQV------------ 270
            |:.|...:|.:|   |:||    ::..|||...:.|.|.:.|...|.:|.|:|            
  Fly   281 LYVAISSSLIVL---VWLHRWIADAPRWLLQHQRVEAALRQLLESATYNNRKVPLTLDVQLTMYA 342

  Fly   271 DDSVFDEFIKH-YREKLNNSQNKSSDTFMGMLRTPRLRKFTIILLIKSMIITIAFDILSRNVEGV 334
            :|.......|| |.:..:....:|...::.::....:..:.||||   ||..:....:..|...:
  Fly   343 NDLDQKSKQKHSYCQVWDGETKRSQLVYIHLIWGGAMVLYNIILL---MIRNLGAQQVHVNTAAM 404

  Fly   335 GISPFKLFSYSGFCYLPAGLTIILFQNKIGRKGMACASLFVG--AIITAATGYLVATLDPSD 394
            |        ::....|..||.:||:..:..|        :.|  .||...:.||:..|..::
  Fly   405 G--------FAEMVGLFVGLYLILYTRRHWR--------WAGNLMIIAGLSTYLIWLLPETE 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17751NP_650816.3 2A0119 11..490 CDD:273328 83/387 (21%)
MFS 109..481 CDD:119392 69/311 (22%)
CG4459NP_650850.1 2A0119 26..536 CDD:273328 83/387 (21%)
MFS 164..540 CDD:119392 71/317 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458362
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.