DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17751 and CG12783

DIOPT Version :9

Sequence 1:NP_650816.3 Gene:CG17751 / 42336 FlyBaseID:FBgn0038717 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001262644.2 Gene:CG12783 / 42019 FlyBaseID:FBgn0038448 Length:493 Species:Drosophila melanogaster


Alignment Length:455 Identity:98/455 - (21%)
Similarity:168/455 - (36%) Gaps:123/455 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 VCD---DAYKLAVGQSFFFIGSALGSIFFGYLADRIGR----LPACVLSTLTGASGDFFTSFVGS 154
            |||   :..:||...:..|:|....|.|:||:.|:.||    |....:|.|...:..|..:|.| 
  Fly    46 VCDLRMNEAQLASLTAAGFMGIICSSYFWGYITDKKGRRWTLLRTITISNLCSLASMFTVTFTG- 109

  Fly   155 LPWFSFTRFISGLFMDTQYVLMYILVFEYLSPQHRTFGLNIILGVFYCVGL-MIS--PWIAIWVT 216
               |...|||:.:|:.....:....:.|:.|  ||.. :..|..::...|. |||  .|..::::
  Fly   110 ---FFVMRFITCIFVAGPSFVAATYLSEFCS--HRIM-VRSITHLYMFTGFAMISCPAWATLFLS 168

  Fly   217 N-----------------WRNYLWAASLPALGMLLFPVFLHESAEWLLTKGKFEKAEKSLRGVAK 264
            :                 ||.......||.:...|..:.|.||.::||..|:.::...::..:::
  Fly   169 SGLIEFEEKLVGSLTLRPWRVLGCLYILPGVVAFLLLLLLPESPKFLLMIGETKRGLDTMEWISR 233

  Fly   265 FN-GRQVDDSVFDEFIKHYREKLNNSQNKSSDTF--------MGMLRTPRLRKFTIILLIKSMII 320
            .| ||.:.:......:. |:|.:...:.|....|        |.::|.|....||.:.::     
  Fly   234 KNTGRTLSEDQMKRLLA-YQEHVQVKRRKEHQNFFRSMLDDAMPLVRKPYGGYFTCVCMV----- 292

  Fly   321 TIAFDILSRNVEGVGISPFKLFSYSGF---CYLPAGLTIILFQNKIGRKGMA-CASLFVGAIITA 381
               ..:|.....|:||      .|:..   |.:..|.|          .||. |..|||     .
  Fly   293 ---MFVLGLLTHGLGI------WYTAMRNRCNMRQGNT----------NGMTFCQVLFV-----P 333

  Fly   382 ATGYLVATLDPSDY-----------SVLLGFMVSLGRYGAVVAYD----------AEAQYAAEII 425
            .||..:.|....|.           |.:|||:.       ||.|:          .:..:...::
  Fly   334 ETGPFIETESDLDVVCSDSFKGFNDSFVLGFVY-------VVLYNISWASLFCVHKKVMFVFSLV 391

  Fly   426 PTSVKGRGVANIHVVGNAFAFFSSYIIYLGTFYKPLPSLMISFI---LLI-------GACLCLAL 480
            .:|.  .|...|....:....||  :::|..|    |.::|..:   ||:       |..||::|
  Fly   392 ASST--FGFLLIFATNHMLQLFS--LVFLIAF----PGIIIGLLGGSLLVFVPTYLRGKALCISL 448

  Fly   481  480
              Fly   449  448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17751NP_650816.3 2A0119 11..490 CDD:273328 98/455 (22%)
MFS 109..481 CDD:119392 93/440 (21%)
CG12783NP_001262644.2 synapt_SV2 <2..>310 CDD:130366 63/285 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458278
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.