DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17751 and CG4324

DIOPT Version :9

Sequence 1:NP_650816.3 Gene:CG17751 / 42336 FlyBaseID:FBgn0038717 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001286807.1 Gene:CG4324 / 37830 FlyBaseID:FBgn0034956 Length:478 Species:Drosophila melanogaster


Alignment Length:479 Identity:100/479 - (20%)
Similarity:168/479 - (35%) Gaps:145/479 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 SITTELEWVCDDAYKLAV----GQSFF-----------------FIGSALGSIFFGYLADRIGRL 132
            |:...|.|: .|:.::|:    |.|.|                 |:|..|.|.|:..|::|.||.
  Fly    59 SLLVGLCWM-SDSMEMAILSILGPSLFCEWNVTKFQQASVTTVVFLGMMLSSSFWTQLSNRYGRK 122

  Fly   133 PACVLSTLTGASGDFFTSFVGSLPWFSFTRFISGLFMD--TQYVLMYILVFEYLSPQHRTFGLNI 195
            .|..|..:........:|...|..|....|.:.|..:.  .|.|.:|.   |:|..:|:  |..:
  Fly   123 SALTLFGVLLVLYSILSSVAPSYAWLLTLRGLVGFAIGCVPQSVTLYA---EFLPTKHK--GKCV 182

  Fly   196 IL-GVFYCVGLMISPWIAIWV---TNWRNYLWAASLPALGMLLFPVFLHESAEWLLTKGKFEKAE 256
            :| ..|:.:|......:|:.|   ..||..|..::.|.|...:...:|.|||.:....|..:||.
  Fly   183 VLMDCFWALGACFEVVLALVVYPYYGWRGLLALSATPLLIFTILSPWLSESARYYSYNGHNDKAI 247

  Fly   257 KSLRGVAKFNGRQV-------DDSVFDEFIKHYREKLNNSQNKSSDTFMGMLRTPRLRKFTIILL 314
            |.|..:|..|.|.:       ||                 :...:::|..:| :|.|.:.||:| 
  Fly   248 KVLEQIAHNNKRHMLMGRLMADD-----------------EPSCAESFRSLL-SPSLYRTTILL- 293

  Fly   315 IKSMIITIAFDILSRNVEGVGISPFKLFSYSGFCYLPAGLTIILFQNKIGRKGMA----CA---- 371
                                    :.|:..|.|||.  ||.::..:..:.|...:    |.    
  Fly   294 ------------------------WFLWLASAFCYY--GLVLVTTELLVARNKESHPNECVTFMT 332

  Fly   372 -----------SLFVGAII------------TAATGYLVATL-------DPSDYSVLLGFMVSLG 406
                       |.|.|.::            |....||...|       ..|.:|..:...::.|
  Fly   333 SDFMDLLWITLSEFPGILLTIKVVKLFGKKKTIVLQYLALVLCTLVLMSVESRFSTSVTLFIARG 397

  Fly   407 RYGAVVAYDAEAQYAAEIIPTSVKGRGVANIHVVGNAFAFF----------SSYIIYLGTFYKPL 461
            ....:  :.|...|..||.|.:::..||:...|:....|..          ||.|..:.|:    
  Fly   398 TISGI--FQAIYVYTPEIYPAALRSVGVSGCSVLARLGAMLTPFVAQVLMDSSRIQAMSTY---- 456

  Fly   462 PSLMISFILLIGACLCLALP-ETL 484
                 :.:.|:.:..|:.|| ||:
  Fly   457 -----AIVGLLASIACVFLPRETV 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17751NP_650816.3 2A0119 11..490 CDD:273328 100/479 (21%)
MFS 109..481 CDD:119392 90/449 (20%)
CG4324NP_001286807.1 2A0119 10..476 CDD:273328 100/479 (21%)
MFS 60..471 CDD:119392 95/472 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458139
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.