DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17751 and CarT

DIOPT Version :9

Sequence 1:NP_650816.3 Gene:CG17751 / 42336 FlyBaseID:FBgn0038717 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_610052.1 Gene:CarT / 35334 FlyBaseID:FBgn0032879 Length:674 Species:Drosophila melanogaster


Alignment Length:585 Identity:156/585 - (26%)
Similarity:252/585 - (43%) Gaps:81/585 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DLQSVLEKCGNFGPYQ-ILLLGLFGYTNIVSSLHYFSQTIISFTP-SHRCSRPE----------- 53
            ||..:|...|.||.|| :|:.|:.....|......|:|..::.|| .:.|..||           
  Fly    35 DLDDLLPTIGEFGKYQKLLVFGICLPACIPCGFCAFNQLFMADTPDDYWCRIPELLDLPLEQRKS 99

  Fly    54 ------------------DYQPNSTSLL------SCSVMQFDKEF---KC-TSWDFERESNYESI 90
                              .|..|.|.||      ..:.|:.:..:   || ..|::.....:.||
  Fly   100 LSIPKELDNDELVYSKCYTYGVNWTQLLESGEEDDLTTMEPNASWPLIKCPQGWEYNTSVVWSSI 164

  Fly    91 TTELEWVCDDAYKLAVGQSFFFIGSALGSIFFGYLADRIGRLPA---CVLSTLTGA-----SGDF 147
            ..:.:.|||......:|.:....|..:|...||.|.||.||..:   |:.:.|.|:     |.||
  Fly   165 VIDFDLVCDQDIYPTIGLAALNTGGPVGVYLFGLLNDRGGRRLSYFVCLATLLAGSLMTSLSKDF 229

  Fly   148 FTSFVGSLPWFSFTRFISGLFMDTQYVLMYILVFEYLSPQHRTFGLNIILGVFYCVGLMISPWIA 212
            :| :.||       |.|.||.:...|.:.:|:..|.:...:|:| :.::...||..|:|:...:.
  Fly   230 WT-WAGS-------RVIVGLTIPAVYQIPFIISLELVGENYRSF-VTVMTCTFYTSGIMLLSGVT 285

  Fly   213 IWVTNWRNYLWAASLPALGMLLFPVFLHESAEWLLTKGKFEKAEKSLRGVAKFNGRQVDDSV--- 274
            ....:|....:..|||.....|:...:.||..|||.:|:.|:|.|.|..:||.|||:..::|   
  Fly   286 YLERDWVRLSYITSLPFYAYFLYMFVMPESPRWLLMRGRLEEALKILERMAKVNGREFPEAVHLK 350

  Fly   275 FDEFIKHYREKLNNSQNKSSDTFMG-MLRTPRLRKFTIILLIKSMIITIAFDILSRNVEGVGISP 338
            .:..|:  |:||...:.|.::..:. :.|||.:|..||::.:........:..||.....:|.:.
  Fly   351 LEAQIR--RDKLKKQKKKMANVGLADLCRTPNMRLKTILITLSWFANETVYLGLSYYGPALGTNQ 413

  Fly   339 FKLFSYSGFCYLPAGLTIILFQNKIGRKGMACASLFVGAIITAATGYLVATLDPSDY--SVLLGF 401
            :..|..|....||:.|....|.:..||:.....|:.:|.:....|..|     |.|.  ..|:.:
  Fly   414 YVSFFLSAVVELPSYLCCWYFMDTWGRRWPLSLSMILGGVACVITVML-----PDDAVDETLVLY 473

  Fly   402 MVSLGRYGA--VVAYDAEAQYAAEIIPTSVKGRGVANIHVVGNAFAFFSSYIIYLGTFYKPLPSL 464
            :||.....|  ::.|    .:|.|:.||.|:|.|:.....:|........:|.|||.....||.:
  Fly   474 LVSKALLSASFLIIY----PFAGELYPTQVRGIGIGASSYIGGLGLIGIPFITYLGKDNLKLPLV 534

  Fly   465 MISFILLIGACLCLALPETLHKNLPQNLEEGEMFAKGEKWYFFPC--FSRRPKTQKSATQLESSD 527
            ::.|:.::|....|.||||||..|||.:||||.|  |:.|.|..|  .:::|:........|:.|
  Fly   535 IMGFLSMLGGMTGLRLPETLHHRLPQTIEEGEEF--GKNWQFKDCCRCAQKPEILSQPASYENLD 597

  Fly   528  527
              Fly   598  597

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17751NP_650816.3 2A0119 11..490 CDD:273328 139/535 (26%)
MFS 109..481 CDD:119392 102/387 (26%)
CarTNP_610052.1 2A0119 44..561 CDD:273328 140/536 (26%)
MFS 182..551 CDD:119392 102/388 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X24
33.010

Return to query results.
Submit another query.