DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17751 and CG33233

DIOPT Version :9

Sequence 1:NP_650816.3 Gene:CG17751 / 42336 FlyBaseID:FBgn0038717 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster


Alignment Length:481 Identity:88/481 - (18%)
Similarity:171/481 - (35%) Gaps:124/481 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 SNYESITTELEWVCDDAYKLAVGQSFFFIGSALGS-IFFGYLADRIGRLPACVLSTLTGASGDFF 148
            :.|..:.|..|:......|..:..|  .:|..:.| :|.|:||||.||.....|:.:...|....
  Fly    40 AGYLVVLTSCEFDTSPKEKTLLANS--LLGGMVASGLFIGFLADRYGRKFVIRLALVGALSFSVI 102

  Fly   149 TSFVGSLPWFSFTRFISGLFMDTQYVLMYILVFEYLSPQHRTFGLNII-----LGVFYC------ 202
            ::.:..|...|..|.|.|.|:.....|....:.|:.:.:.|...:.|.     |.:.||      
  Fly   103 SALMPDLYSLSVIRIIVGTFLSAVASLQVGFLGEFHAIKWRPITVAICSQSQGLALIYCPLVAMA 167

  Fly   203 -------VGLMISPWIAIW--------VTNWRNYLWAASLPALGMLLFPVFLHESAEWLLTKGKF 252
                   |.|..|..:.:|        :..|        |..:|:.|.|    |:..:|::..:.
  Fly   168 ILPNNFNVDLSSSYNLRVWRFLMMFFMIPGW--------LALVGICLVP----ETPHFLMSVNRP 220

  Fly   253 EKAEKSLRGVAKFNGRQVDDSVFDEFIKHYREKLNNSQNKSSDTFM-GMLRT-----------PR 305
            :||..:|:.:.:.|.::.:|           ..:..|:.|||.... |..:|           |.
  Fly   221 DKALLALKWICRMNRKKWED-----------VDITLSEEKSSTNDQEGFWKTVWYEYKLLFSKPH 274

  Fly   306 LRKFTIILLI------KSMIITIAFDILSRNVEGVG----------------------------- 335
            :.||.|.|.:      .|:.:.|.|.:: ||::..|                             
  Fly   275 VFKFFICLFLIFGIFFTSIGLGIWFPVI-RNMDNSGSNRLCDLVNNNPTFINHEADDTNGTDSES 338

  Fly   336 ----------ISPFKLFSYSGFCYLPAGLTIILFQNKIGRKGMACASLFVGAIITAATGYLVATL 390
                      |.|.    |.||.|:...:...:..:.:.||.:....:.:..|:..:...:   .
  Fly   339 PKCNDEMTNLIDPV----YYGFTYIGCFILASVLVHWMTRKYVIALHILISMILGISLNIM---K 396

  Fly   391 DPSDYSVLLGFMVSLGRYGAVVAYDAEAQYAAEIIPTSVKGRGVANIHVVGNAFAFFSSYIIYLG 455
            .|:  .||:.|::.:...|.::  ........:.:|.:::|:.:..:..:........|.:|  |
  Fly   397 QPT--VVLIFFVLMMVLPGVLI--PLATSVLVDCLPVNLRGKALCMVRSLARFGGVLGSTMI--G 455

  Fly   456 TFYKPLPSLMIS-FILLIGACLCLAL 480
            .|.:....:..: |.|.:..|:.||:
  Fly   456 LFIRVTCDVTFNIFNLCLAICVVLAV 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17751NP_650816.3 2A0119 11..490 CDD:273328 88/481 (18%)
MFS 109..481 CDD:119392 84/457 (18%)
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 79/447 (18%)
MFS 23..>208 CDD:119392 38/177 (21%)
MFS 354..>482 CDD:304372 22/137 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458230
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.