DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17751 and T05A1.5

DIOPT Version :9

Sequence 1:NP_650816.3 Gene:CG17751 / 42336 FlyBaseID:FBgn0038717 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001366751.1 Gene:T05A1.5 / 188077 WormBaseID:WBGene00011456 Length:359 Species:Caenorhabditis elegans


Alignment Length:339 Identity:76/339 - (22%)
Similarity:139/339 - (41%) Gaps:80/339 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LQSVLEKCGNFGPYQILLLGLFGYTNIVSSLHYFSQTIISFTPSHRCSRPEDYQPNSTSLLSCSV 67
            ::.:|::.|.:.||.:.:.....:..::|.:...|.:.::  ||..|           :|.:||.
 Worm    69 VEDLLDQIGIWHPYPLFITFSMAFLWLLSVMPTMSPSYMA--PSSPC-----------TLDNCSF 120

  Fly    68 MQFDKEFKCTSWDFERESNYESITTELEWVCDDAYKLAVGQSFFFIGSALGSIFFGYLADRIGRL 132
            :....||..|                 :.:.|..   .:..|.||:|:.:....:...||||||.
 Worm   121 VTVQNEFNIT-----------------KTLIDPG---EMTSSIFFLGNGILGQIYAVAADRIGRR 165

  Fly   133 PACVLST-LTGASGDFFTSFVGS--LPWFSFT---RFISGLFMDTQYVLMYILVFEYLSPQHR-- 189
            |..:.|. ::|.||      :|:  .|.|...   ||..|.......::.:::..|.:|....  
 Worm   166 PVLIASLFISGLSG------IGAAYAPTFEIMLIGRFFQGSCFTALTMINWVMCCESISFSGHGY 224

  Fly   190 ---TFGLNIILGVFYCVGLMISPWIAIWVTNWRNYLWAASLPAL--GMLLFPVFLHESAEWLLTK 249
               .|||..::|  ||   .:|| :|::.:.||....|.|:|.:  |:|:. ..|.||..:|:.|
 Worm   225 ASVLFGLCWVIG--YC---SVSP-LAMYFSTWRYVQLATSVPCVLFGILMM-FTLPESFSFLVAK 282

  Fly   250 GKFEKAEKSLRGVAKFNGRQVD---DSVFDEFIKHYREKLNNSQNKSSDTFMGMLRTPRLRKFTI 311
            .|.:...|.:...::....::|   |.:.|   ...||:.|.|          :|:|.:|     
 Worm   283 RKRDDLVKWIEMASRVGNEEIDYDADQIVD---MSSREEDNES----------LLQTLKL----- 329

  Fly   312 ILLIKSMIITIAFD 325
            :|..|.|:...|.:
 Worm   330 VLQSKLMVTNTAVE 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17751NP_650816.3 2A0119 11..490 CDD:273328 75/331 (23%)
MFS 109..481 CDD:119392 60/233 (26%)
T05A1.5NP_001366751.1 MFS 117..>271 CDD:421695 45/186 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163084
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.