DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17751 and T08B1.1

DIOPT Version :10

Sequence 1:NP_650816.3 Gene:CG17751 / 42336 FlyBaseID:FBgn0038717 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001300188.1 Gene:T08B1.1 / 178678 WormBaseID:WBGene00020340 Length:612 Species:Caenorhabditis elegans


Alignment Length:122 Identity:27/122 - (22%)
Similarity:40/122 - (32%) Gaps:51/122 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 GALGVIWCM--------VWYKTVHDRPEDD-PKISTS---------ELALLQRDAVSQNH----- 260
            |..|.::|:        ||      :|.|: |.::.|         :..|:....|:|.|     
 Worm   228 GCNGRVFCLQDEPGVHRVW------QPVDESPGLAMSRAFGDYCIKDYGLVSVPEVTQRHISIRD 286

  Fly   261 -YIVPWAQILRSKPVWAVIVAHSAQNLGFYIMLTNLPKMLKDIAGYNVEKAGIASSL 316
             :|     ||.:..||.||....|                .||.....|:|..|..|
 Worm   287 QFI-----ILATDGVWDVISNQEA----------------IDIVSSTAERAKAAKRL 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17751NP_650816.3 2A0119 11..490 CDD:273328 27/122 (22%)
T08B1.1NP_001300188.1 2A0119 77..541 CDD:273328 27/122 (22%)

Return to query results.
Submit another query.