DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7342 and CG4324

DIOPT Version :9

Sequence 1:NP_001247196.1 Gene:CG7342 / 42335 FlyBaseID:FBgn0038716 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001286807.1 Gene:CG4324 / 37830 FlyBaseID:FBgn0034956 Length:478 Species:Drosophila melanogaster


Alignment Length:527 Identity:111/527 - (21%)
Similarity:190/527 - (36%) Gaps:154/527 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 PASIESP-------VDSSCLPLNRNISTPNTCYSYNYEL-YMGYQSFPSEMD------WVCADAW 105
            ||::.||       |.||.|.|......|:..|:....: ..|:..|..::.      |: :|:.
  Fly     8 PAALPSPANLAPRDVHSSTLELKTVSINPDDTYTVQQAINAFGFGWFHVKLSLLVGLCWM-SDSM 71

  Fly   106 KLT----LGQSMF-----------------FVGSVVGSMVLGYLADVVGRLPILIVANLIAMTGN 149
            ::.    ||.|:|                 |:|.::.|.....|::..||...|.:..::.:..:
  Fly    72 EMAILSILGPSLFCEWNVTKFQQASVTTVVFLGMMLSSSFWTQLSNRYGRKSALTLFGVLLVLYS 136

  Fly   150 LLTIWSTNVTLFCMFRMISGIATD--SNFVMMYILVMEYMRPSVRTLGLSICIGFFYCLGSMAAP 212
            :|:..:.:.......|.:.|.|..  ...|.:|   .|:: |:.......:.:..|:.||:....
  Fly   137 ILSSVAPSYAWLLTLRGLVGFAIGCVPQSVTLY---AEFL-PTKHKGKCVVLMDCFWALGACFEV 197

  Fly   213 WIAVLM---RSWRGFLLTTSLPLLVVPFFYLIVPESIQWLISKQKY-------DSAVVCLKRVAK 267
            .:|:::   ..|||.|..::.|||:   |.::.|    ||....:|       |.|:..|:::|.
  Fly   198 VLALVVYPYYGWRGLLALSATPLLI---FTILSP----WLSESARYYSYNGHNDKAIKVLEQIAH 255

  Fly   268 INGRHV--------EESAYAEFIEECKCSQQNQKASPHLLDLFQTPRLRRHTLILFFKSMVITLC 324
            .|.||:        :|.:.||....             ||    :|.|.|.|::|:|..:....|
  Fly   256 NNKRHMLMGRLMADDEPSCAESFRS-------------LL----SPSLYRTTILLWFLWLASAFC 303

  Fly   325 YDA---------VSRNVQG-------LGISPFVMFSLSATAILPACLLIIALQDRIGRKAMASAS 373
            |..         |:||.:.       ...|.|:.......:..|..||.|.:....|:|      
  Fly   304 YYGLVLVTTELLVARNKESHPNECVTFMTSDFMDLLWITLSEFPGILLTIKVVKLFGKK------ 362

  Fly   374 LLLSGIFISVTGGIIFAASASDKTTTL---------LVSLSVVGRFGVTVA-----------YNS 418
                                  ||..|         ||.:||..||..:|.           :.:
  Fly   363 ----------------------KTIVLQYLALVLCTLVLMSVESRFSTSVTLFIARGTISGIFQA 405

  Fly   419 GAQYATELIPTCVRGQGVAAVHV---AGYAFTFFSAYILFTRSVFSPLPEIILGVLSLLGACLCL 480
            ...|..|:.|..:|..||:...|   .|...|.|.|.:|...|....:.  ...::.||.:..|:
  Fly   406 IYVYTPEIYPAALRSVGVSGCSVLARLGAMLTPFVAQVLMDSSRIQAMS--TYAIVGLLASIACV 468

  Fly   481 LLP-ETL 486
            .|| ||:
  Fly   469 FLPRETV 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7342NP_001247196.1 2A0119 12..491 CDD:273328 111/527 (21%)
MFS 93..>243 CDD:119392 34/181 (19%)
CG4324NP_001286807.1 2A0119 10..476 CDD:273328 109/525 (21%)
MFS 60..471 CDD:119392 94/469 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458135
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.