DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7342 and CG33233

DIOPT Version :9

Sequence 1:NP_001247196.1 Gene:CG7342 / 42335 FlyBaseID:FBgn0038716 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster


Alignment Length:479 Identity:88/479 - (18%)
Similarity:180/479 - (37%) Gaps:107/479 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 YSYNYELYMGYQSFPSEMDWVCADAWKLTLGQSMFFVGSVVGSMVLGYLADVVGRLPILIVANLI 144
            ||....:..||....:..::..:...|..|..|: ..|.|...:.:|:|||..||..::.:|.:.
  Fly    32 YSVTESMTAGYLVVLTSCEFDTSPKEKTLLANSL-LGGMVASGLFIGFLADRYGRKFVIRLALVG 95

  Fly   145 AMTGNLLTIWSTNVTLFCMFRMISGIATDSNFVMMYILVMEYMRPSVRTLGLSIC-----IGFFY 204
            |::.::::....::....:.|:|.|....:...:....:.|:.....|.:.::||     :...|
  Fly    96 ALSFSVISALMPDLYSLSVIRIIVGTFLSAVASLQVGFLGEFHAIKWRPITVAICSQSQGLALIY 160

  Fly   205 CLGSMAAPWIAVL---------------MRSWRGFLLTTSLPLLVVPFFYLIVPESIQWLISKQK 254
            |      |.:|:.               :|.||..::...:|..:......:|||:..:|:|..:
  Fly   161 C------PLVAMAILPNNFNVDLSSSYNLRVWRFLMMFFMIPGWLALVGICLVPETPHFLMSVNR 219

  Fly   255 YDSAVVCLKRVAKINGRHVEESAYAEFIEECKCSQQNQK--------------ASPHLLDLFQTP 305
            .|.|::.||.:.::|.:..|:....  :.|.|.|..:|:              :.||:...|...
  Fly   220 PDKALLALKWICRMNRKKWEDVDIT--LSEEKSSTNDQEGFWKTVWYEYKLLFSKPHVFKFFICL 282

  Fly   306 RLRRHTLILFFKSMVITLCYDAVSRNVQGLGIS----------PFVMFSLSAT----AILPAC-- 354
            .|   ...:||.|:.:.:.:..: ||:...|.:          .|:......|    :..|.|  
  Fly   283 FL---IFGIFFTSIGLGIWFPVI-RNMDNSGSNRLCDLVNNNPTFINHEADDTNGTDSESPKCND 343

  Fly   355 -------------------LLIIALQDRIGRKAMASASLLLS---GIFISVTGGIIFAASASDKT 397
                               :|...|...:.||.:.:..:|:|   ||.:::         ....|
  Fly   344 EMTNLIDPVYYGFTYIGCFILASVLVHWMTRKYVIALHILISMILGISLNI---------MKQPT 399

  Fly   398 TTLLVSLSVVGRFGVTVAYNSGAQYATELIPTCVRGQGVAAVH-VAGYAFTFFSAYI-LFTRSVF 460
            ..|:..:.::...||.:..  ......:.:|..:||:.:..|. :|.:.....|..| ||.|...
  Fly   400 VVLIFFVLMMVLPGVLIPL--ATSVLVDCLPVNLRGKALCMVRSLARFGGVLGSTMIGLFIRVTC 462

  Fly   461 SPLPEIILGVLSLLGACL--CLLL 482
                ::...:.:|   ||  |::|
  Fly   463 ----DVTFNIFNL---CLAICVVL 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7342NP_001247196.1 2A0119 12..491 CDD:273328 88/479 (18%)
MFS 93..>243 CDD:119392 28/169 (17%)
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 78/442 (18%)
MFS 23..>208 CDD:119392 32/182 (18%)
MFS 354..>482 CDD:304372 27/144 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458226
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.