DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7333 and GIT1

DIOPT Version :9

Sequence 1:NP_650814.2 Gene:CG7333 / 42334 FlyBaseID:FBgn0038715 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_010022.1 Gene:GIT1 / 850462 SGDID:S000000695 Length:518 Species:Saccharomyces cerevisiae


Alignment Length:160 Identity:37/160 - (23%)
Similarity:58/160 - (36%) Gaps:51/160 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LLYGYTN------ILGSLHYFSQTLITFTPEHWCFHADLNGLSVEGIRSVYENISA-SSCTPLLG 79
            |::|::.      |:|..:   ..|...||....|:|.:|.|...|...:...||: :|.|.:.|
Yeast   338 LMFGFSGYIIFGLIIGCAY---DQLKKITPLFIIFYAFMNMLGNAGPGDMLGVISSEASATAVRG 399

  Fly    80 VVNGTGVVSTNRKCRNWIFNRESGYESITTELKWVCDKSHHPAVGQSFFFMGSVVGTIIFGYLSD 144
            |..|...|:..                                       :|||||...|..:.|
Yeast   400 VFYGLSAVTGK---------------------------------------IGSVVGVECFQPIRD 425

  Fly   145 QVGRLPSLLMATLCGATGDFITSFV--HTL 172
            .:|...:.::|.:||..|..||.|.  |:|
Yeast   426 NLGARWTFIIAAICGLIGIIITYFFVPHSL 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7333NP_650814.2 2A0119 11..510 CDD:273328 37/160 (23%)
MFS 126..499 CDD:119392 17/49 (35%)
GIT1NP_010022.1 MFS_PhT 48..454 CDD:340922 35/157 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.