DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7333 and SVOP

DIOPT Version :9

Sequence 1:NP_650814.2 Gene:CG7333 / 42334 FlyBaseID:FBgn0038715 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_061181.1 Gene:SVOP / 55530 HGNCID:25417 Length:548 Species:Homo sapiens


Alignment Length:471 Identity:95/471 - (20%)
Similarity:173/471 - (36%) Gaps:103/471 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 SITTELKWVCD--------------------KSHHPAVGQSFFFMGSVVGTIIFGYLSDQVGRLP 150
            |:.|.|.|:.|                    .|...|:..|..|:|.:..:.::|.:|||.||..
Human    87 SVLTGLAWMADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFVGMMSSSTLWGNISDQYGRKT 151

  Fly   151 SLLMATLCGATGDFITSFVHTLPWFAFSRFMSGL------STDTMYYLMYILVFEYLSPKSRTFG 209
            .|.::.|.......:::|.....|....|.:.|.      .:.|:|       .|:|..|:|...
Human   152 GLKISVLWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSVTLY-------AEFLPMKARAKC 209

  Fly   210 LNIILAVFYCFGLMTSPWAAIWIG---NWRRYLWLASLPALGVLIYPFLICESAQWLLTKRKYDD 271
            : :::.||:..|.:.....|:::.   .||..|.|:::|.|...:..|.:.|||::.:.....:.
Human   210 I-LLIEVFWAIGTVFEVVLAVFVMPSLGWRWLLILSAVPLLLFAVLCFWLPESARYDVLSGNQEK 273

  Fly   272 AVICLKKVAKFN------------RRHVEESVFDEFVKYYRERELQDYKLNSHEDTFLAMFL--T 322
            |:..||::|..|            |:.....:.|.|..::|            ..|.|..|:  :
Human   274 AIATLKRIATENGAPMPLGKLIISRQEDRGKMRDLFTPHFR------------WTTLLLWFIWFS 326

  Fly   323 PRLRRFTLTLLVKSVIITLS-CDVINRN----------MEGLGTSPFKLFSFTSIVYLPAGVAIL 376
            .....:.|.||...:..... |.:.:|.          .|.|....:....:|::...|..:..|
Human   327 NAFSYYGLVLLTTELFQAGDVCGISSRKKAVEAKCSLACEYLSEEDYMDLLWTTLSEFPGVLVTL 391

  Fly   377 LLQNKIGRKGMACTALFVGGLITTATGFMIAHLDPTENALLLAIMVG---------LGRFGATVS 432
            .:.:::|||.            |.|..|:|...    .:|||.|.||         :.|...:..
Human   392 WIIDRLGRKK------------TMALCFVIFSF----CSLLLFICVGRNVLTLLLFIARAFISGG 440

  Fly   433 YDAEIQYAAEIIPTSVRGQAV---SNIHVIGLASSSLAFYVIYLAQYYKPLPSIFISCLMFFGAG 494
            :.|...|..|:.||:.|...:   |.:..:|...:.....|:..:..|..| :::..|.:.....
Human   441 FQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVMLESSVYLTL-AVYSGCCLLAALA 504

  Fly   495 LCLTLPETLNKKLPET 510
            .|....||..:.|.|:
Human   505 SCFLPIETKGRGLQES 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7333NP_650814.2 2A0119 11..510 CDD:273328 94/469 (20%)
MFS 126..499 CDD:119392 84/418 (20%)
SVOPNP_061181.1 MFS_SVOP 87..509 CDD:340999 91/458 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.