DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7333 and CG4324

DIOPT Version :9

Sequence 1:NP_650814.2 Gene:CG7333 / 42334 FlyBaseID:FBgn0038715 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_001286807.1 Gene:CG4324 / 37830 FlyBaseID:FBgn0034956 Length:478 Species:Drosophila melanogaster


Alignment Length:449 Identity:96/449 - (21%)
Similarity:162/449 - (36%) Gaps:133/449 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 SITTELKWVCDKSHHPAV----GQSFF-----------------FMGSVVGTIIFGYLSDQVGRL 149
            |:...|.|:.| |...|:    |.|.|                 |:|.::.:..:..||::.||.
  Fly    59 SLLVGLCWMSD-SMEMAILSILGPSLFCEWNVTKFQQASVTTVVFLGMMLSSSFWTQLSNRYGRK 122

  Fly   150 PSLLMATLCGATGDFITSFVHTLPWFAFSRFMSGLS------TDTMYYLMYILVFEYLSPKSRTF 208
            .:|.:..:.......::|...:..|....|.:.|.:      :.|:|       .|:|..|.:  
  Fly   123 SALTLFGVLLVLYSILSSVAPSYAWLLTLRGLVGFAIGCVPQSVTLY-------AEFLPTKHK-- 178

  Fly   209 GLNIIL-----AVFYCF----GLMTSPWAAIWIGNWRRYLWLASLPALGVLIYPFLICESAQWLL 264
            |..::|     |:..||    .|:..|:.     .||..|.|::.|.|...|....:.|||::..
  Fly   179 GKCVVLMDCFWALGACFEVVLALVVYPYY-----GWRGLLALSATPLLIFTILSPWLSESARYYS 238

  Fly   265 TKRKYDDAVICLKKVAKFNRRHV---------EESVFDEFVKYYRERELQDYKLNSHEDTFLAMF 320
            .....|.|:..|:::|..|:||:         |.|..:.|      |.|                
  Fly   239 YNGHNDKAIKVLEQIAHNNKRHMLMGRLMADDEPSCAESF------RSL---------------- 281

  Fly   321 LTPRLRRFTLTL----LVKS------VIITLSCDVINRNMEG-------LGTSPF---------- 358
            |:|.|.|.|:.|    |..:      |::|... ::.||.|.       ..||.|          
  Fly   282 LSPSLYRTTILLWFLWLASAFCYYGLVLVTTEL-LVARNKESHPNECVTFMTSDFMDLLWITLSE 345

  Fly   359 -----------KLFSFTSIV---YLPAGVAILLLQNKIGRKGMACTALFVGGLITTATGFMIAHL 409
                       |||.....:   ||...:..|:|.:...|...:.|.....|.|:.....:..:.
  Fly   346 FPGILLTIKVVKLFGKKKTIVLQYLALVLCTLVLMSVESRFSTSVTLFIARGTISGIFQAIYVYT 410

  Fly   410 DPTENALLLAIMVG----LGRFGATVSYDAEIQYAAEIIPTSVRGQAVSNIHVIGLASS 464
            .....|.|.::.|.    |.|.||.::     .:.|:::..|.|.||:|...::||.:|
  Fly   411 PEIYPAALRSVGVSGCSVLARLGAMLT-----PFVAQVLMDSSRIQAMSTYAIVGLLAS 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7333NP_650814.2 2A0119 11..510 CDD:273328 96/449 (21%)
MFS 126..499 CDD:119392 89/425 (21%)
CG4324NP_001286807.1 2A0119 10..476 CDD:273328 96/449 (21%)
MFS 60..471 CDD:119392 95/448 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458137
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.