DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7333 and Slc22a5

DIOPT Version :9

Sequence 1:NP_650814.2 Gene:CG7333 / 42334 FlyBaseID:FBgn0038715 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_062142.1 Gene:Slc22a5 / 29726 RGDID:3702 Length:557 Species:Rattus norvegicus


Alignment Length:546 Identity:153/546 - (28%)
Similarity:233/546 - (42%) Gaps:63/546 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DFSQVLDKCGNYGRFQVMILLLYGYTNILGSLHYFSQTLITFTPEHWCFHADLNGLSVEGIRSVY 66
            |:.:|....|.:|.||.:|..|...:.|....:..|...:..||||.|.......||     |.:
  Rat     3 DYDEVTAFLGEWGPFQRLIFFLLSASIIPNGFNGMSIVFLAGTPEHRCLVPHTVNLS-----SAW 62

  Fly    67 ENIS-----------ASSCT----------PLLGVVNGTGVVSTNRKCRN----WIFNRESGYES 106
            .|.|           ..||.          ..||:..|..|.....:..|    |.:|::....:
  Rat    63 RNHSIPLETKDGRQVPQSCRRYRLATIANFSALGLEPGRDVDLEQLEQENCLDGWEYNKDVFLST 127

  Fly   107 ITTELKWVCDKSHHPAVGQSFFFMGSVVGTIIFGYLSDQVGRLPSLLMATLCGATG-DFITSFVH 170
            |.||...||.......:..|.||:|.::|:.|.|.|||:.|| .::|..|:...|| .|:..|..
  Rat   128 IVTEWDLVCKDDWKAPLTTSLFFVGVLMGSFISGQLSDRFGR-KNVLFLTMGMQTGFSFLQLFSV 191

  Fly   171 TLPWFAFSRFMSGLSTDTMYYLMYILVFEYLSPKSRTFGLNIILAVFYCFGLMTSPWAAIWIGNW 235
            ....|.....:.|:...:.|...::|..|.||...|.....:.:.:||.||.|..|..|.:|.:|
  Rat   192 NFEMFTVLFVLVGMGQISNYVAAFVLGTEILSKSIRIIFATLGVCIFYAFGFMVLPLFAYFIRDW 256

  Fly   236 RRYLWLASLPALGVLIYP--FLICESAQWLLTKRKYDDAVICLKKVAKFNRRHVEESVFDEFVKY 298
            |..|...::|  |||...  :.|.||.:||:::.:..:|.:.::|.||||......::||     
  Rat   257 RMLLLALTVP--GVLCGALWWFIPESPRWLISQGRVKEAEVIIRKAAKFNGIVAPSTIFD----- 314

  Fly   299 YRERELQDYKLNSHEDTFLAMFLTPRLRRFTLTLLVKSVIITLSCDV-------INRNMEG-LGT 355
              ..||||  |||.:.....::...|.|...: :.:.|:|:.|:..|       ...|:.| :..
  Rat   315 --PSELQD--LNSKKPQSHHIYDLVRTRNIRI-ITIMSIILWLTISVGYFGLSLDTPNLHGDIYV 374

  Fly   356 SPFKLFSFTSIVYLPAGVAILLLQNKIGRKGMACTALFVGGLITTATGFMIAHLDPTENALLLAI 420
            :.|.|    :.|.:||.|...||...:.|:.....|||:||.:     .:...|.|:|...|...
  Rat   375 NCFLL----AAVEVPAYVLAWLLLQHLPRRYSISAALFLGGSV-----LLFIQLVPSELFYLSTA 430

  Fly   421 MVGLGRFGATVSYDAEIQYAAEIIPTSVRGQAVSNIHVIGLASSSLAFYVIYLAQYYKPLPSIFI 485
            :|.:|:||.|.:|.....|.||:.||.||...|..........|.|:.|.:||..|.:.||.|.:
  Rat   431 LVMVGKFGITSAYSMVYVYTAELYPTVVRNMGVGVSSTASRLGSILSPYFVYLGAYDRFLPYILM 495

  Fly   486 SCLMFFGAGLCLTLPETLNKKLPETL 511
            ..|....|.|.|..||:....||:|:
  Rat   496 GSLTILTAILTLFFPESFGAPLPDTI 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7333NP_650814.2 2A0119 11..510 CDD:273328 150/534 (28%)
MFS 126..499 CDD:119392 114/383 (30%)
Slc22a5NP_062142.1 2A0119 12..520 CDD:273328 150/534 (28%)
MFS 123..510 CDD:119392 119/408 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 537..557
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347293
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57756
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24064
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X24
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.