DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7333 and T05A1.5

DIOPT Version :9

Sequence 1:NP_650814.2 Gene:CG7333 / 42334 FlyBaseID:FBgn0038715 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_001366751.1 Gene:T05A1.5 / 188077 WormBaseID:WBGene00011456 Length:359 Species:Caenorhabditis elegans


Alignment Length:217 Identity:56/217 - (25%)
Similarity:94/217 - (43%) Gaps:31/217 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 SFFFMGSVVGTIIFGYLSDQVGRLPSLLMATLCGATGDFITSFVHTLPWFAFSRFMSGLSTDTMY 190
            |.||:|:.:...|:...:|::||.|.|:.:...........::..|.......||..|.....:.
 Worm   142 SIFFLGNGILGQIYAVAADRIGRRPVLIASLFISGLSGIGAAYAPTFEIMLIGRFFQGSCFTALT 206

  Fly   191 YLMYILVFEYLS-----PKSRTFGLNIILAVFYCFGLMTSPWAAIWIGNWRRYLWLA-SLPAL-- 247
            .:.:::..|.:|     ..|..|||..::.  ||   ..|| .|::...| ||:.|| |:|.:  
 Worm   207 MINWVMCCESISFSGHGYASVLFGLCWVIG--YC---SVSP-LAMYFSTW-RYVQLATSVPCVLF 264

  Fly   248 GVLIYPFLICESAQWLLTKRKYDDAVICLKKVAKFNRRHVEESVFDEFVKYYRERE-----LQDY 307
            |:|:. |.:.||..:|:.|||.||.|..::..::.....::... |:.|......|     ||..
 Worm   265 GILMM-FTLPESFSFLVAKRKRDDLVKWIEMASRVGNEEIDYDA-DQIVDMSSREEDNESLLQTL 327

  Fly   308 KL---------NSHEDTFLAMF 320
            ||         |:..:|||..|
 Worm   328 KLVLQSKLMVTNTAVETFLWKF 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7333NP_650814.2 2A0119 11..510 CDD:273328 56/217 (26%)
MFS 126..499 CDD:119392 56/217 (26%)
T05A1.5NP_001366751.1 MFS 117..>271 CDD:421695 34/136 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163082
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.