DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr92A and LOC4578368

DIOPT Version :10

Sequence 1:NP_650813.2 Gene:Cpr92A / 42333 FlyBaseID:FBgn0038714 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_001238134.2 Gene:LOC4578368 / 4578368 VectorBaseID:AGAMI1_001083 Length:193 Species:Anopheles gambiae


Alignment Length:83 Identity:47/83 - (56%)
Similarity:58/83 - (69%) Gaps:1/83 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 EPYDPDPKYSFGYDIQDGYTGDLKSQHETRHGDVVKGSYSVVDPDGTKRTVDYTADPHHGFNAVV 124
            |.|.| ..|.|.|.:.|.:|||:||||||||||.|:|.||::|.||.:|.||||||.|:||||||
Mosquito   104 EEYAP-ANYEFSYSVHDSHTGDVKSQHETRHGDQVQGQYSLLDADGHQRIVDYTADDHNGFNAVV 167

  Fly   125 RKEPLAYKAPAHLAPVVA 142
            |:||...|....:..|:|
Mosquito   168 RREPANVKVAQPVQKVIA 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr92ANP_650813.2 Chitin_bind_4 68..120 CDD:459790 32/51 (63%)
LOC4578368XP_001238134.2 None

Return to query results.
Submit another query.