DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr92A and Ccp84Aa

DIOPT Version :9

Sequence 1:NP_650813.2 Gene:Cpr92A / 42333 FlyBaseID:FBgn0038714 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_649683.1 Gene:Ccp84Aa / 40825 FlyBaseID:FBgn0004783 Length:205 Species:Drosophila melanogaster


Alignment Length:236 Identity:97/236 - (41%)
Similarity:113/236 - (47%) Gaps:51/236 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 AMLGIAYAGVIGPGPYYGGPAGPGPLHHYGGYAPQHGPLPGPYVAPKPA--APEPYDPDPKYSFG 71
            |:....||.:..|..|:..||       ...||  |.|:.   ||.|..  |.|.|||.|:|.|.
  Fly    13 AVASAGYAPIAAPQVYHAAPA-------VATYA--HAPVA---VAQKVVVKAAEEYDPHPQYRFS 65

  Fly    72 YDIQDGYTGDLKSQHETRHGDVVKGSYSVVDPDGTKRTVDYTADPHHGFNAVVRKEPLAYKAPAH 136
            |.:.|..|||.|.|.|.|.||||:|.||::|.||.||.|.|||||.:||||||.:|||. ||.| 
  Fly    66 YGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRIVQYTADPINGFNAVVNREPLV-KAVA- 128

  Fly   137 LAPVVAPAPAPVPAHYGPAPAPPLPPVPKAPLLSYPLALGPYHRGAPAPAPGPAPA---PAPAPV 198
            :||||....|||..:..||.|                     |..|||.....||.   .|||  
  Fly   129 VAPVVKTVAAPVAQYAAPAVA---------------------HYAAPAVVKTVAPVAHYAAPA-- 170

  Fly   199 SVPVATPVLPSAHFHAAYPALAHSPYA---HYPAPGPAPAP 236
               |...|.|.||:  |.|| |::.||   ||.||..|..|
  Fly   171 ---VVKTVAPVAHY--AAPA-AYATYAAPTHYAAPAVAYHP 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr92ANP_650813.2 PHA03185 <21..77 CDD:177553 20/57 (35%)
Chitin_bind_4 68..120 CDD:278791 29/51 (57%)
Ccp84AaNP_649683.1 Chitin_bind_4 62..114 CDD:278791 29/51 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D147941at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.