DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr92A and Ccp84Ac

DIOPT Version :9

Sequence 1:NP_650813.2 Gene:Cpr92A / 42333 FlyBaseID:FBgn0038714 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_649681.1 Gene:Ccp84Ac / 40823 FlyBaseID:FBgn0004781 Length:217 Species:Drosophila melanogaster


Alignment Length:247 Identity:91/247 - (36%)
Similarity:117/247 - (47%) Gaps:41/247 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ISLLSAMLGIAYAGVIGPGPYYGGPAGPGPLHH--YGGYAPQHGPLPGPY-VAPKPAAPEPYDPD 65
            ::|:|..|....||:|        |......|.  |..:.|||......: :.|......|.||.
  Fly     6 VALVSCCLAAVSAGLI--------PVEQHDQHPQLYQAHQPQHVIYQKQHEIHPHGHEVYPDDPH 62

  Fly    66 PKYSFGYDIQDGYTGDLKSQHETRHGDVVKGSYSVVDPDGTKRTVDYTADPHHGFNAVVRKEPLA 130
            |||:|.||:||..:||.|||.|:|.||||:|.||:.|.||.:|||.||||..:||||||.:||||
  Fly    63 PKYNFAYDVQDALSGDSKSQVESRDGDVVQGEYSLDDADGFRRTVKYTADSVNGFNAVVHREPLA 127

  Fly   131 YKAPAHLAPVVAPAPAPVPAHYGPAPAPPLPPVPKAPLLSY--PLALGPYHRGAPAPAPGPAPAP 193
            :   .|...|.|   |||..|:.||.|..:.....:|..:|  |....|.:. |||.|...|..|
  Fly   128 H---VHHKVVAA---APVQYHHAPAAAAAVIKSYASPSQAYVAPTYAAPAYT-APAYATHQAEQP 185

  Fly   194 APAPVSVPVATPVLPSAHFHAAYPALAHSPYAHYPAPGPAPAPVEPHAYYHH 245
            ....          ...|.:|:|.:.||:..||           |.|.||||
  Fly   186 QERE----------HQQHHYASYESPAHAQAAH-----------EGHEYYHH 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr92ANP_650813.2 PHA03185 <21..77 CDD:177553 17/58 (29%)
Chitin_bind_4 68..120 CDD:278791 30/51 (59%)
Ccp84AcNP_649681.1 Chitin_bind_4 65..117 CDD:278791 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D147941at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.