DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr92A and Ccp84Af

DIOPT Version :10

Sequence 1:NP_650813.2 Gene:Cpr92A / 42333 FlyBaseID:FBgn0038714 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster


Alignment Length:156 Identity:66/156 - (42%)
Similarity:83/156 - (53%) Gaps:18/156 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KISLLSAMLGIAYAGVIGPGP----YYGGPAGPGPLHHYGGYAPQHGPLPGPYVAP-KPAAPEPY 62
            |...:.|::..|.|||:   |    |:..||       ...||  ..|:...:..| ...|.|.|
  Fly     4 KFFAVLALISAASAGVL---PVQQVYHAAPA-------VATYA--QAPVAVAHAQPVLTKATEEY 56

  Fly    63 DPDPKYSFGYDIQDGYTGDLKSQHETRHGDVVKGSYSVVDPDGTKRTVDYTADPHHGFNAVVRKE 127
            ||.|:|.|.||:||..:||.|||.|.|.||||.|.||::|.||.||.|.||:||.:||||||.:.
  Fly    57 DPHPQYKFAYDVQDSLSGDSKSQVEERDGDVVHGEYSLIDSDGYKRIVQYTSDPVNGFNAVVNRV 121

  Fly   128 PLAY-KAPAHLAPVVAPAPAPVPAHY 152
            ||.: |........||.|.||:|..|
  Fly   122 PLDHVKTVVKTVAPVAVAAAPIPVAY 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr92ANP_650813.2 Chitin_bind_4 68..120 CDD:459790 30/51 (59%)
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:459790 30/51 (59%)

Return to query results.
Submit another query.