DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr92A and Cpr72Ea

DIOPT Version :9

Sequence 1:NP_650813.2 Gene:Cpr92A / 42333 FlyBaseID:FBgn0038714 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_648882.1 Gene:Cpr72Ea / 39814 FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster


Alignment Length:266 Identity:72/266 - (27%)
Similarity:98/266 - (36%) Gaps:65/266 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PLHHYGGYAPQHG---PLPGPYVAPKPAAPEP-------YDPDPKYSFGYDIQDGYTGDLKSQHE 87
            ||...|..:..||   ..|..|.|...|...|       .|...:||:      ||:..|.|:.|
  Fly     4 PLLLLGSLSLAHGLALYYPYAYTAEGSAVFTPTQRQYIAKDELGQYSY------GYSEPLSSKQE 62

  Fly    88 TRHGD-VVKGSYSVVDPDGTKRTVDYTADPHHGFNAVVRKEPLAYKAP---AHLAPVVAPAPAPV 148
            ||..| :.:|.||..|..|..:||:|.|| :.||:......|.| |.|   ...:|..|..|.. 
  Fly    63 TRTLDGITQGYYSYRDAAGKLQTVNYVAD-NKGFHVAATNLPKA-KVPQESLEFSPRSASHPVD- 124

  Fly   149 PAHYGPAPAPPLPPVPKAPLLSYPLALGPYHR-----GAPAPAPGPAP----------APAPA-- 196
              |:....|.....|.:.|:..:|:.: |:|.     |..|...|..|          |..|.  
  Fly   125 --HHVEHHAEVSHAVVQHPVGHHPIEV-PHHHTVVESGRSAHPDGHHPVEHHEHRVAVAQHPVGH 186

  Fly   197 -PVSVPVATPVL-------PSAHF---HAAYP-ALAHSPYAHYPA----------PGPAPAPVEP 239
             ||.||....|:       |..|.   |..:| |:|..|..::|.          .|.:..|..|
  Fly   187 HPVEVPHHHTVVETGRSAHPDGHHPVEHHEHPVAVAQHPVGNHPVEVPHHHTVVESGRSAHPEVP 251

  Fly   240 HAYYHH 245
            |:..||
  Fly   252 HSIEHH 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr92ANP_650813.2 PHA03185 <21..77 CDD:177553 13/53 (25%)
Chitin_bind_4 68..120 CDD:278791 20/52 (38%)
Cpr72EaNP_648882.1 Chitin_bind_4 49..95 CDD:278791 20/52 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.