DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr92A and Cpr65Ec

DIOPT Version :10

Sequence 1:NP_650813.2 Gene:Cpr92A / 42333 FlyBaseID:FBgn0038714 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_648077.1 Gene:Cpr65Ec / 38775 FlyBaseID:FBgn0035737 Length:127 Species:Drosophila melanogaster


Alignment Length:86 Identity:26/86 - (30%)
Similarity:35/86 - (40%) Gaps:20/86 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 DPKYSFGYDIQDGYTGDLKSQHETRHGDVVKGSYSVVDPDGTKRTVDYTADPHHGFNAVVRKEPL 129
            |..|::.|...:|..|    |.....|....||.:...|||....:.|||| .:|:         
  Fly    38 DGSYAYQYQTSNGIAG----QESGVGGYYASGSNAYYAPDGQLIQLTYTAD-SNGY--------- 88

  Fly   130 AYKAPAHLAPVVAPAPAPVPA 150
             :.|.|||     |.|.|:||
  Fly    89 -HPAGAHL-----PTPPPIPA 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr92ANP_650813.2 Chitin_bind_4 68..120 CDD:459790 15/51 (29%)
Cpr65EcNP_648077.1 Chitin_bind_4 41..88 CDD:459790 15/51 (29%)

Return to query results.
Submit another query.