DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr92A and Cpr65Eb

DIOPT Version :10

Sequence 1:NP_650813.2 Gene:Cpr92A / 42333 FlyBaseID:FBgn0038714 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster


Alignment Length:85 Identity:22/85 - (25%)
Similarity:34/85 - (40%) Gaps:20/85 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 DPKYSFGYDIQDGYTGDLKSQHETRHGDVVKGSYSVVDPDGTKRTVDYTADPHHGFNAVVRKEPL 129
            |..|::.::..:|    :..|.:...|....||.....|:|....:.|||| .:||      :|.
  Fly    43 DGIYNYQFETSNG----IAQQEQGVGGYYASGSSQYYTPEGQLIQLTYTAD-ENGF------QPQ 96

  Fly   130 AYKAPAHLAPVVAPAPAPVP 149
            .    .||     |.|.|:|
  Fly    97 G----EHL-----PTPHPIP 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr92ANP_650813.2 Chitin_bind_4 68..120 CDD:459790 12/51 (24%)
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:459790 12/51 (24%)

Return to query results.
Submit another query.