DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr92A and Cpr64Ad

DIOPT Version :9

Sequence 1:NP_650813.2 Gene:Cpr92A / 42333 FlyBaseID:FBgn0038714 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_647875.1 Gene:Cpr64Ad / 38511 FlyBaseID:FBgn0035513 Length:247 Species:Drosophila melanogaster


Alignment Length:219 Identity:83/219 - (37%)
Similarity:100/219 - (45%) Gaps:68/219 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLSAMLG--IAYAGVIGPGPY-----------------YGGP--AGPGPL--HHYGG-------- 39
            |.:|.||  :||:..:||.||                 |..|  |||.||  ..|..        
  Fly    26 LAAAPLGAPLAYSAPLGPAPYFAPAAYSAPLGYAAPLGYNAPLVAGPAPLVSKTYAAAPFAAPFA 90

  Fly    40 ---------------------YAPQHGPLPGPYVAP------KPAAPEPYDPDPKYSFGYDIQDG 77
                                 .||...||..|..||      .|.|.|..|..|:|.|.||:||.
  Fly    91 APVAPVAARLAAPVAAPLAAPVAPVAAPLAAPVAAPLAAPVAAPIATEIVDAHPQYKFAYDVQDT 155

  Fly    78 YTGDLKSQHETRHGDVVKGSYSVVDPDGTKRTVDYTADPHHGFNAVVRKE----------PLAYK 132
            .|||.|:|.|||.||||:||||:::|||::|.|.|.||..:||||||:|:          .||..
  Fly   156 LTGDSKTQEETRDGDVVRGSYSLIEPDGSRRIVSYYADSINGFNAVVQKDVPVAVAPVAPVLAKT 220

  Fly   133 APAHLAPVVAPAPAPVPAHYGPAP 156
            ..|.:|||||.|||||.|....||
  Fly   221 VAAPVAPVVAAAPAPVFAKTLAAP 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr92ANP_650813.2 PHA03185 <21..77 CDD:177553 28/111 (25%)
Chitin_bind_4 68..120 CDD:278791 30/51 (59%)
Cpr64AdNP_647875.1 Chitin_bind_4 146..198 CDD:306811 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.