DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr92A and Cpr64Ac

DIOPT Version :9

Sequence 1:NP_650813.2 Gene:Cpr92A / 42333 FlyBaseID:FBgn0038714 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_647874.1 Gene:Cpr64Ac / 38510 FlyBaseID:FBgn0035512 Length:188 Species:Drosophila melanogaster


Alignment Length:192 Identity:76/192 - (39%)
Similarity:91/192 - (47%) Gaps:33/192 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLSAMLGIAY--AGVIGPGPYYGGP----------AGP----GPLHHYGGYAPQHGP--LPGPYV 52
            :|||::.|..  .|:..||..|..|          |.|    .|...|...|..:.|  |..|..
  Fly    12 ILSAVVAIPIDPYGLSAPGLTYAAPKLLAAPAISYAAPKLLAAPAISYAAPAISYAPKVLAAPVA 76

  Fly    53 APKPAAPEPYDPDPKYSFGYDIQDGYTGDLKSQHETRHGDVVKGSYSVVDPDGTKRTVDYTADPH 117
            ..|.|..|||||:|:|||.|.:.|.:|||.|.|.||....||.||||:.:||||.|.|.||||..
  Fly    77 VAKVAVAEPYDPNPQYSFSYGVTDHHTGDSKQQEETLVNGVVHGSYSLAEPDGTIRKVTYTADKV 141

  Fly   118 HGFNAVVRKEPLAYKAPAHLAPVVAPAPAPVPAHYGPAPAPPLPPVPKAPLLSYPLALGPYH 179
            :||||||.|:.:|..|.|..|..||..||.....|..||.               |:||.||
  Fly   142 NGFNAVVEKKGVAAVAIAKPALAVAAVPAITKIGYASAPG---------------LSLGGYH 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr92ANP_650813.2 PHA03185 <21..77 CDD:177553 24/71 (34%)
Chitin_bind_4 68..120 CDD:278791 28/51 (55%)
Cpr64AcNP_647874.1 Chitin_bind_4 92..144 CDD:395303 28/51 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.